SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  99883.ENSTNIP00000011087
Domain Number - Region: 155-219,329-369
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0518
Family Spectrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011087
Sequence length 547
Comment (Tetraodon nigroviridis)
Sequence
TKMAAVVNYSPPWWVNLLHRLPHFNLEFQIVSSDFRPEDSEYQKSILLLSAIALLCLALD
LLFLLFYSFWLCCRRRKSDDSSSHSHSHSQQPSADCCCTAWCVIIATLVCSAGIAVGFYG
NGESSDGASRVVYSLRHANHTISGVEKLVSDSSLALNQTVEENLVQLESAYKEQTDYVSI
VQKLQGQLDELVRLVADVPFWSNTAVSLEQLAQRTEAFDFYRWLGYLGLLLFDVLICLLV
LFGLIRNSRSTLIGVCLLGVLTLIISWGSLGLELAVAASASDFCVSPDTYVTRVTEENAV
INQDILQYYLRCSSGQVNPFQQRLSGSHKALVEMQDDVADSSACVCSLSASCVQANLEQI
QSVLNATEVGLHQLTALVDCRSLHMDYVQALTGLCYDGVEGLIYLVLFSFVTALMFSSIV
CSVPHTWPGKTDGRTDEEDGEDESGASRGGIHDNLYRVHMPSLYSCGSSYGSEASLPATA
HTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSYTSSMRAKYLATNRPDQNRRSVP
NDQLDPA
Download sequence
Identical sequences H3CS53
ENSTNIP00000011087 99883.ENSTNIP00000011087 ENSTNIP00000011087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]