SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019109
Domain Number 1 Region: 30-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-78
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1335-1450
Classification Level Classification E-value
Superfamily E set domains 3.8e-37
Family Filamin repeat (rod domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 1531-1643
Classification Level Classification E-value
Superfamily E set domains 3.27e-31
Family Filamin repeat (rod domain) 0.00000805
Further Details:      
 
Domain Number 4 Region: 1067-1157
Classification Level Classification E-value
Superfamily E set domains 5e-31
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 5 Region: 467-575
Classification Level Classification E-value
Superfamily E set domains 8.67e-31
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 6 Region: 1448-1557
Classification Level Classification E-value
Superfamily E set domains 1e-30
Family Filamin repeat (rod domain) 0.0000274
Further Details:      
 
Domain Number 7 Region: 1850-1945
Classification Level Classification E-value
Superfamily E set domains 1e-29
Family Filamin repeat (rod domain) 0.00000956
Further Details:      
 
Domain Number 8 Region: 1246-1356
Classification Level Classification E-value
Superfamily E set domains 8.67e-29
Family Filamin repeat (rod domain) 0.0000234
Further Details:      
 
Domain Number 9 Region: 561-668
Classification Level Classification E-value
Superfamily E set domains 1.67e-28
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 10 Region: 748-873
Classification Level Classification E-value
Superfamily E set domains 4e-28
Family Filamin repeat (rod domain) 0.00078
Further Details:      
 
Domain Number 11 Region: 673-769
Classification Level Classification E-value
Superfamily E set domains 1.33e-27
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 12 Region: 2036-2129
Classification Level Classification E-value
Superfamily E set domains 5.66e-27
Family Filamin repeat (rod domain) 0.0000402
Further Details:      
 
Domain Number 13 Region: 863-973
Classification Level Classification E-value
Superfamily E set domains 5.74e-27
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 14 Region: 1161-1269
Classification Level Classification E-value
Superfamily E set domains 2.14e-26
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 15 Region: 282-377
Classification Level Classification E-value
Superfamily E set domains 3.87e-26
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 16 Region: 2311-2401
Classification Level Classification E-value
Superfamily E set domains 8.01e-26
Family Filamin repeat (rod domain) 0.00000824
Further Details:      
 
Domain Number 17 Region: 380-477
Classification Level Classification E-value
Superfamily E set domains 2.87e-24
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 18 Region: 2502-2593
Classification Level Classification E-value
Superfamily E set domains 9.34e-24
Family Filamin repeat (rod domain) 0.00000996
Further Details:      
 
Domain Number 19 Region: 2637-2726
Classification Level Classification E-value
Superfamily E set domains 2.14e-23
Family Filamin repeat (rod domain) 0.0000118
Further Details:      
 
Domain Number 20 Region: 2244-2325
Classification Level Classification E-value
Superfamily E set domains 2e-22
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 21 Region: 1632-1743
Classification Level Classification E-value
Superfamily E set domains 4.2e-22
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 22 Region: 961-1064
Classification Level Classification E-value
Superfamily E set domains 4.74e-22
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 23 Region: 2409-2498
Classification Level Classification E-value
Superfamily E set domains 2.8e-21
Family Filamin repeat (rod domain) 0.0000151
Further Details:      
 
Domain Number 24 Region: 1952-2032
Classification Level Classification E-value
Superfamily E set domains 1e-16
Family Filamin repeat (rod domain) 0.0000688
Further Details:      
 
Domain Number 25 Region: 1782-1866
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000193
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019109
Sequence length 2728
Comment (Tetraodon nigroviridis)
Sequence
MMSNNYEEQLPPQYYQATDFGEEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
NKTISDLQREFTDGLKLISLLEVLSQKKMYRKYHTRPNFRQMKLENVSVALEFLERERIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNKV
PQLPINNFNRDWQDGKALGALVDNCAPGLCPDWAEWDPNEPVQNAREAMQQADDWLGVPQ
VIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPLRPKQLFPNKVKAYGPGIEPHGNKVL
QPAVFTVDTLEAGSGEVLVYVEDPEGHTEEAKVKPNKDKSRTYTVTYVPKVEGVHKVKVL
FAGQDIDKSPYTVNVAKAMGDPSKVHARGPGLDPVGNVANKPTYFDIYTAGAGNGDISVV
IIDPGKKDTVELILENKGESVFRCTYRPVLEGPHTIHVLFAEQEIPKSPYTVNIAEAVNP
NACRATGRGLQPKGVRVKEVADFKVFTKGAGSGELKVSVKGPTGAEEQVKVQDAGNAVYN
CEYYPLKPGKYTVSITWGGHPIPRSPFEVEVGGEAGVQKVRAWGPGLKTGMVGKSADFVV
EAIGVDVGTLGFSIEGPSQAKIECDDKDDGSCDVHYWPTEPGDYAVHVICDDEDIKDSPF
IAHILPAANDTFPEKVKAYGPGLKPTGVIVNKPTEFTIDARLAGKGHLTIYAQDAEGCTI
NIEIADKGDGTYLCVYTPVKPIKHTIIITWGEVNVPNSPFRVLVGEGSHPDKVKVYGPGV
EKTGLKANEPTYFTVDCSEAGQALGDISIGIKCAPGVVGPGEADIDFDIIKNDNDTFTVK
YTPPAPGRYTIMVLFAEQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFTI
YTKGAGKAKPEVHFAASRPGEAVRDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPIP
KSPFHITVAPPLDIGKVKVEGLDNKVEVGKDQEFTVNTKGAGGQGNVGVKMTSPSGRPIP
CKLESDKAKGIHSVKYIPPEEGHYKVDVSYDGNPVMGSPFGVEAVMPADPSKVRAFGPGL
QGGIVGKPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGSCSVYYLPTEPGEYAIN
ILFADQHIPGSPFKAPVRMALDPSKVTASGPGLERAKAGEPATFTVDCTRAGDAELTIEI
VSETGAKAEVHIQKTAQGIFSVTYIPPFHGAHTITIKYGGHMIPHFPKVLQVDPSVDTSG
VHVYGPGVEPRGVLRDVTTHFIVDARALKKAGGNHVKVHVINPSGTKTESYLTDKGDGTY
RVEYTAFEDGIHLIEVLYDDVPVPKSPFRVSVVEGCDPSRVRAFGPGLEGGITNKPNCFT
VETRGAGTGGLGLTIEGASEAKISCKDNKDGSCSVEYIPFTPGDYDVNITYGGHPIPGSP
FQVPVKDPVDPSKVKCSGPGLGTGVRAHVPQTFTVDCTKAGQAPLDVKLYGPTGTAEPVG
VKNNGDGTHTVHYTPAQDGPYTVAVKYAEQEVPHSPFKVMSQPGHDASKVRASGPGLDTK
GVSASLPVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTI
TIKYGGDEIPYSPYRIQSLPTGDASKCLLTVSIGGHGVSANLQKLQTSEDTVITVDAKAA
GKGKVTCKVQTPQGMELDMDVVENHDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVV
VGKKSIYLADVCVCVCSVVSFYATNEPVVPRDTVDPLFRPVNFLVPFTPQQGEITGEVRM
PSGKTARPHITDNKDGTITIKYQPTERGLHEMDIKYEGNQIPGSPLQFFVDAVNTGVVTA
YGPGLSYGTVNKAATFTVVTKNAGEGGLSLAVEGPSKAEITCKDNKDGTCLVSYLPTAPG
DYNIIVKFDNKHIPGSPFTAKITGDDTITRTSQLNVGTSADVSLKIAETDLSSLTASIRA
PSGNEEPCLLKKLPNRHLGISFTPKEVGEHEVSVRKNGVHVANSPFKIMVGQSEIGEASR
VKAFGKGLVEAHTSEMAEFFVDTRNAGYGGLALSIEGPSKVDINCEDMEDRTCKVTYCPT
EPGNYNVNIKFAEKHIPGSPFTVKVTGEGRIRESITRKRQASSLASVGSTCGLNLKIPGN
WFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGGGSPFRDV
FGDFLGRESLSSFAGITARPEVECGPQTMTAQVTSPSGKTVDADIVDGGNSTYSVRFIPQ
EMGPHTVNVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAAAPSEFSIWTRE
AGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVKEPGDYEVSIKFNNEHIPDSPFIVPI
ATLSDEARRLTVTSLQEKDLKVNQEASFMVQRNGARGVVDAKVHTPSGSSEECYVTELDS
DKNAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLIGDPGMVTAHGAGLQGGITG
APSEFVVKTCNAGSGTLSVNIDGPSKVKLDCRECPEGYKITYTPMAPGNYLIAIKYGGPQ
HIVGSPFKAKITGARLSGGHSLHETSSVLVETVTKTAKVGGAYKSASSSSSTTLTSDASK
VVCRGTGLTKALVGQKNNFTVDCSKAGTNMLMVGVHGPHTPCEEVYVKHMGNKLYNVTYA
IKDKGSYQIIVKWGDDNVPGSPYKVVAP
Download sequence
Identical sequences H3DF15
99883.ENSTNIP00000019109 ENSTNIP00000019109 ENSTNIP00000000464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]