SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16765169|ref|NP_460784.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16765169|ref|NP_460784.1|
Domain Number 1 Region: 288-421
Classification Level Classification E-value
Superfamily CBS-domain pair 1.26e-20
Family CBS-domain pair 0.0066
Further Details:      
 
Domain Number 2 Region: 433-517
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.82e-17
Family CorC/HlyC domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|16765169|ref|NP_460784.1|
Domain Number - Region: 7-227
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16765169|ref|NP_460784.1|
Sequence length 518
Comment inner membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
Sequence
MELLMDPSIWVGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLIGLSLALIMRLA
LLSIISWLVTLTKPLFTVWDFTFSGRDLIMLLGGIFLLFKATTELHERLENREHDTGHGK
GYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSIVIEVFNQIARRNFIRHQS
TLPLRARTADAILRLMGGKRQASTQHETDSPAAISVSEGAFAEEERYMINGVLTLASRSL
RGIMTPRGEISWVDANLSVAEIRQQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEG
ADVAAIAASSPAIVVPETLDPINLLGVLRARGSFVIVTNEFGVVQGLVTPLDVLEAIAGE
FPDADETPEIVADAEGWIVKGGTDLHALQQALEVDHLVNEEGDIATVAGLVIAANGHIPR
VGDVIDVPPLRITIVEANDYRVDLVRIVKEQPAHDEEE
Download sequence
Identical sequences 99287.STM1828 gi|16765169|ref|NP_460784.1| AE006468|CDS_1928060-1926504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]