SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16765449|ref|NP_461064.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16765449|ref|NP_461064.1|
Domain Number 1 Region: 290-424
Classification Level Classification E-value
Superfamily CBS-domain pair 8.29e-27
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 437-523
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.12e-21
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16765449|ref|NP_461064.1|
Sequence length 526
Comment inner membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
Sequence
MEWIADPSIWAGLVTLIVIELVLGIDNLVFIAILAEKLPPGQRDRARITGLILAMIMRLL
LLASISWLVTLTKPLFSVQALSFSARDLIMLFGGFFLLFKATMELNERLEGKDSANPTQR
KGAKFWAVVAQIVVLDAIFSLDSVITAVGMVDHLAVMMAAVIIAISLMLLASKSLTRFVN
NHPTIVILCLSFLLMIGFSLVAEGFGFHIPKGYLYAAIGFSVMIEALNQLAIFNRRRFLS
ANHTLRQRTTEAVMRLISGKKEDAELDAETAAMLADHDDSQIFNPQERRMIERVLNLNQR
TVSSIMTSRHDIEHIDLNAPEAEIRALLEKNQHTRLVVTGENEQEDLLGVVHVIDLLQQS
LRGEPLNLRALIRQPLVFPETLPLLPALEQFRNARTHFAFVVDEFGSVEGIVTLSDVMET
IAGNLPNEVEEIDARHDIQKNPDGSWTANGHMPLEDLVQYVPLPLDEKREYHTIAGLLME
YLQRIPQTGEEVQVGDYLLKTLQVESHRVQKVQLIPLHNGEPDQEM
Download sequence
Identical sequences A0A0D6FGN8 A0A0F6B3H0 A0A0F7JA60 A0A0H3NES0 A0A0M0QF68 A0A0R9P2K2 A0A0T7RQY5 A0A0U1FAM8 A0A1X2UVP7 A0A249UX03 A0A267SNK9 A0A2D1XCW3 A0A2D3ADK2 A0A2H9YI83 E8XCV7 Q8ZNQ8 S5HV67 V7IQ90
gi|383496828|ref|YP_005397517.1| NP_461064.1.58477 WP_000454713.1.100007 WP_000454713.1.100010 WP_000454713.1.100115 WP_000454713.1.10013 WP_000454713.1.1002 WP_000454713.1.100234 WP_000454713.1.100258 WP_000454713.1.100266 WP_000454713.1.100288 WP_000454713.1.100376 WP_000454713.1.100424 WP_000454713.1.100436 WP_000454713.1.100438 WP_000454713.1.100484 WP_000454713.1.100488 WP_000454713.1.100502 WP_000454713.1.100521 WP_000454713.1.100584 WP_000454713.1.100597 WP_000454713.1.100711 WP_000454713.1.100721 WP_000454713.1.100750 WP_000454713.1.10076 WP_000454713.1.100781 WP_000454713.1.100790 WP_000454713.1.100793 WP_000454713.1.100869 WP_000454713.1.100871 WP_000454713.1.100882 WP_000454713.1.100932 WP_000454713.1.100948 WP_000454713.1.101007 WP_000454713.1.101020 WP_000454713.1.101042 WP_000454713.1.101074 WP_000454713.1.101078 WP_000454713.1.101091 WP_000454713.1.101094 WP_000454713.1.101123 WP_000454713.1.101180 WP_000454713.1.101185 WP_000454713.1.101259 WP_000454713.1.101284 WP_000454713.1.101291 WP_000454713.1.101320 WP_000454713.1.101353 WP_000454713.1.101386 WP_000454713.1.101404 WP_000454713.1.101420 WP_000454713.1.101473 WP_000454713.1.101589 WP_000454713.1.101612 WP_000454713.1.101639 WP_000454713.1.101707 WP_000454713.1.101724 WP_000454713.1.101734 WP_000454713.1.101740 WP_000454713.1.101815 WP_000454713.1.101841 WP_000454713.1.101878 WP_000454713.1.10191 WP_000454713.1.101953 WP_000454713.1.102009 WP_000454713.1.10220 WP_000454713.1.10237 WP_000454713.1.10266 WP_000454713.1.10429 WP_000454713.1.10439 WP_000454713.1.10507 WP_000454713.1.10521 WP_000454713.1.10675 WP_000454713.1.10678 WP_000454713.1.10720 WP_000454713.1.10753 WP_000454713.1.10797 WP_000454713.1.10992 WP_000454713.1.11000 WP_000454713.1.11024 WP_000454713.1.11031 WP_000454713.1.11168 WP_000454713.1.11190 WP_000454713.1.11213 WP_000454713.1.11295 WP_000454713.1.11304 WP_000454713.1.11362 WP_000454713.1.11369 WP_000454713.1.1137 WP_000454713.1.11455 WP_000454713.1.11458 WP_000454713.1.11518 WP_000454713.1.11543 WP_000454713.1.11565 WP_000454713.1.11621 WP_000454713.1.11763 WP_000454713.1.11772 WP_000454713.1.11865 WP_000454713.1.11897 WP_000454713.1.11936 WP_000454713.1.12025 WP_000454713.1.12047 WP_000454713.1.12059 WP_000454713.1.12063 WP_000454713.1.12114 WP_000454713.1.12244 WP_000454713.1.12280 WP_000454713.1.12351 WP_000454713.1.12370 WP_000454713.1.12396 WP_000454713.1.12484 WP_000454713.1.12546 WP_000454713.1.12584 WP_000454713.1.1264 WP_000454713.1.12650 WP_000454713.1.12718 WP_000454713.1.12728 WP_000454713.1.12879 WP_000454713.1.12936 WP_000454713.1.12995 WP_000454713.1.13027 WP_000454713.1.13101 WP_000454713.1.13106 WP_000454713.1.13130 WP_000454713.1.1326 WP_000454713.1.13311 WP_000454713.1.13334 WP_000454713.1.13414 WP_000454713.1.13446 WP_000454713.1.13488 WP_000454713.1.13509 WP_000454713.1.13669 WP_000454713.1.13741 WP_000454713.1.13829 WP_000454713.1.1387 WP_000454713.1.13908 WP_000454713.1.13932 WP_000454713.1.13968 WP_000454713.1.14001 WP_000454713.1.14041 WP_000454713.1.14151 WP_000454713.1.14212 WP_000454713.1.14239 WP_000454713.1.14286 WP_000454713.1.14320 WP_000454713.1.14379 WP_000454713.1.14406 WP_000454713.1.14410 WP_000454713.1.14446 WP_000454713.1.14466 WP_000454713.1.14505 WP_000454713.1.14516 WP_000454713.1.14524 WP_000454713.1.14528 WP_000454713.1.14554 WP_000454713.1.14725 WP_000454713.1.14737 WP_000454713.1.14852 WP_000454713.1.1489 WP_000454713.1.14932 WP_000454713.1.14936 WP_000454713.1.15046 WP_000454713.1.15055 WP_000454713.1.15079 WP_000454713.1.15100 WP_000454713.1.15124 WP_000454713.1.15223 WP_000454713.1.15226 WP_000454713.1.15316 WP_000454713.1.15353 WP_000454713.1.15369 WP_000454713.1.1540 WP_000454713.1.15479 WP_000454713.1.15483 WP_000454713.1.15508 WP_000454713.1.1551 WP_000454713.1.15586 WP_000454713.1.15612 WP_000454713.1.15625 WP_000454713.1.15708 WP_000454713.1.15784 WP_000454713.1.158 WP_000454713.1.15830 WP_000454713.1.15909 WP_000454713.1.1592 WP_000454713.1.15978 WP_000454713.1.15995 WP_000454713.1.1601 WP_000454713.1.16028 WP_000454713.1.16052 WP_000454713.1.16062 WP_000454713.1.16063 WP_000454713.1.16103 WP_000454713.1.16158 WP_000454713.1.16226 WP_000454713.1.16233 WP_000454713.1.16273 WP_000454713.1.16284 WP_000454713.1.16331 WP_000454713.1.1635 WP_000454713.1.16468 WP_000454713.1.16581 WP_000454713.1.16614 WP_000454713.1.16650 WP_000454713.1.16656 WP_000454713.1.1668 WP_000454713.1.16686 WP_000454713.1.16691 WP_000454713.1.167 WP_000454713.1.16732 WP_000454713.1.16735 WP_000454713.1.16786 WP_000454713.1.16819 WP_000454713.1.16826 WP_000454713.1.16855 WP_000454713.1.16858 WP_000454713.1.1689 WP_000454713.1.16896 WP_000454713.1.16941 WP_000454713.1.16965 WP_000454713.1.1700 WP_000454713.1.17098 WP_000454713.1.17285 WP_000454713.1.17307 WP_000454713.1.1737 WP_000454713.1.17390 WP_000454713.1.174 WP_000454713.1.17447 WP_000454713.1.17480 WP_000454713.1.17546 WP_000454713.1.17702 WP_000454713.1.17703 WP_000454713.1.17705 WP_000454713.1.17755 WP_000454713.1.17949 WP_000454713.1.17991 WP_000454713.1.18019 WP_000454713.1.18089 WP_000454713.1.18111 WP_000454713.1.1814 WP_000454713.1.18163 WP_000454713.1.18178 WP_000454713.1.18192 WP_000454713.1.18249 WP_000454713.1.18265 WP_000454713.1.18267 WP_000454713.1.18281 WP_000454713.1.18282 WP_000454713.1.18445 WP_000454713.1.18468 WP_000454713.1.18485 WP_000454713.1.18607 WP_000454713.1.18692 WP_000454713.1.18705 WP_000454713.1.18715 WP_000454713.1.18776 WP_000454713.1.18822 WP_000454713.1.18881 WP_000454713.1.18919 WP_000454713.1.18940 WP_000454713.1.18949 WP_000454713.1.1897 WP_000454713.1.19030 WP_000454713.1.19038 WP_000454713.1.19053 WP_000454713.1.19320 WP_000454713.1.19357 WP_000454713.1.1939 WP_000454713.1.19458 WP_000454713.1.19460 WP_000454713.1.19461 WP_000454713.1.19469 WP_000454713.1.19614 WP_000454713.1.19642 WP_000454713.1.19683 WP_000454713.1.19702 WP_000454713.1.19706 WP_000454713.1.19724 WP_000454713.1.19749 WP_000454713.1.19784 WP_000454713.1.19802 WP_000454713.1.19809 WP_000454713.1.19851 WP_000454713.1.19867 WP_000454713.1.1990 WP_000454713.1.1998 WP_000454713.1.20 WP_000454713.1.20023 WP_000454713.1.20034 WP_000454713.1.20081 WP_000454713.1.20089 WP_000454713.1.20119 WP_000454713.1.20212 WP_000454713.1.20266 WP_000454713.1.20271 WP_000454713.1.20330 WP_000454713.1.20362 WP_000454713.1.20391 WP_000454713.1.20418 WP_000454713.1.20425 WP_000454713.1.20443 WP_000454713.1.20525 WP_000454713.1.2054 WP_000454713.1.20553 WP_000454713.1.20626 WP_000454713.1.20646 WP_000454713.1.20695 WP_000454713.1.20721 WP_000454713.1.20789 WP_000454713.1.20795 WP_000454713.1.20839 WP_000454713.1.20886 WP_000454713.1.20908 WP_000454713.1.2091 WP_000454713.1.21049 WP_000454713.1.21089 WP_000454713.1.21246 WP_000454713.1.21269 WP_000454713.1.21400 WP_000454713.1.21497 WP_000454713.1.21499 WP_000454713.1.21548 WP_000454713.1.21603 WP_000454713.1.21692 WP_000454713.1.21751 WP_000454713.1.21757 WP_000454713.1.21792 WP_000454713.1.21845 WP_000454713.1.21981 WP_000454713.1.22024 WP_000454713.1.22030 WP_000454713.1.2205 WP_000454713.1.22062 WP_000454713.1.22067 WP_000454713.1.22117 WP_000454713.1.2221 WP_000454713.1.2224 WP_000454713.1.22240 WP_000454713.1.22323 WP_000454713.1.2235 WP_000454713.1.22379 WP_000454713.1.22427 WP_000454713.1.22485 WP_000454713.1.22514 WP_000454713.1.22537 WP_000454713.1.22575 WP_000454713.1.22582 WP_000454713.1.22620 WP_000454713.1.22623 WP_000454713.1.22676 WP_000454713.1.22845 WP_000454713.1.22870 WP_000454713.1.22979 WP_000454713.1.23080 WP_000454713.1.23102 WP_000454713.1.23114 WP_000454713.1.2314 WP_000454713.1.23148 WP_000454713.1.23155 WP_000454713.1.23172 WP_000454713.1.23192 WP_000454713.1.23258 WP_000454713.1.23259 WP_000454713.1.23274 WP_000454713.1.23309 WP_000454713.1.23460 WP_000454713.1.23466 WP_000454713.1.23472 WP_000454713.1.23482 WP_000454713.1.23503 WP_000454713.1.23529 WP_000454713.1.23621 WP_000454713.1.23634 WP_000454713.1.2364 WP_000454713.1.23643 WP_000454713.1.23670 WP_000454713.1.23675 WP_000454713.1.23685 WP_000454713.1.23736 WP_000454713.1.23755 WP_000454713.1.2376 WP_000454713.1.23932 WP_000454713.1.24017 WP_000454713.1.24163 WP_000454713.1.24206 WP_000454713.1.24259 WP_000454713.1.24308 WP_000454713.1.24325 WP_000454713.1.24376 WP_000454713.1.24392 WP_000454713.1.24433 WP_000454713.1.24444 WP_000454713.1.24555 WP_000454713.1.24567 WP_000454713.1.24578 WP_000454713.1.24696 WP_000454713.1.24723 WP_000454713.1.24737 WP_000454713.1.24779 WP_000454713.1.24837 WP_000454713.1.25008 WP_000454713.1.25015 WP_000454713.1.25036 WP_000454713.1.25072 WP_000454713.1.25205 WP_000454713.1.25206 WP_000454713.1.2525 WP_000454713.1.25405 WP_000454713.1.25454 WP_000454713.1.25493 WP_000454713.1.25498 WP_000454713.1.25514 WP_000454713.1.25564 WP_000454713.1.25668 WP_000454713.1.25690 WP_000454713.1.25722 WP_000454713.1.25740 WP_000454713.1.25793 WP_000454713.1.25814 WP_000454713.1.25944 WP_000454713.1.25988 WP_000454713.1.26030 WP_000454713.1.26123 WP_000454713.1.26199 WP_000454713.1.26269 WP_000454713.1.26282 WP_000454713.1.26311 WP_000454713.1.26319 WP_000454713.1.2634 WP_000454713.1.26363 WP_000454713.1.26384 WP_000454713.1.26426 WP_000454713.1.26429 WP_000454713.1.26440 WP_000454713.1.26493 WP_000454713.1.26512 WP_000454713.1.26551 WP_000454713.1.26567 WP_000454713.1.26576 WP_000454713.1.26582 WP_000454713.1.2660 WP_000454713.1.26856 WP_000454713.1.26883 WP_000454713.1.27010 WP_000454713.1.27173 WP_000454713.1.272 WP_000454713.1.27206 WP_000454713.1.2723 WP_000454713.1.27279 WP_000454713.1.27342 WP_000454713.1.27419 WP_000454713.1.27423 WP_000454713.1.27513 WP_000454713.1.27522 WP_000454713.1.27561 WP_000454713.1.27616 WP_000454713.1.2763 WP_000454713.1.27665 WP_000454713.1.27707 WP_000454713.1.27713 WP_000454713.1.27755 WP_000454713.1.27761 WP_000454713.1.2777 WP_000454713.1.27776 WP_000454713.1.27857 WP_000454713.1.27969 WP_000454713.1.27977 WP_000454713.1.28002 WP_000454713.1.28094 WP_000454713.1.28126 WP_000454713.1.28170 WP_000454713.1.28225 WP_000454713.1.28235 WP_000454713.1.2825 WP_000454713.1.28267 WP_000454713.1.2829 WP_000454713.1.28302 WP_000454713.1.2835 WP_000454713.1.28370 WP_000454713.1.28393 WP_000454713.1.28514 WP_000454713.1.28538 WP_000454713.1.28575 WP_000454713.1.28612 WP_000454713.1.28625 WP_000454713.1.28655 WP_000454713.1.28694 WP_000454713.1.28775 WP_000454713.1.28776 WP_000454713.1.2879 WP_000454713.1.28811 WP_000454713.1.2890 WP_000454713.1.28938 WP_000454713.1.28946 WP_000454713.1.28977 WP_000454713.1.29006 WP_000454713.1.29010 WP_000454713.1.29099 WP_000454713.1.2910 WP_000454713.1.29255 WP_000454713.1.29454 WP_000454713.1.29588 WP_000454713.1.29601 WP_000454713.1.29606 WP_000454713.1.29615 WP_000454713.1.29619 WP_000454713.1.29704 WP_000454713.1.29732 WP_000454713.1.29774 WP_000454713.1.29775 WP_000454713.1.29923 WP_000454713.1.29924 WP_000454713.1.29969 WP_000454713.1.30006 WP_000454713.1.30027 WP_000454713.1.30179 WP_000454713.1.30180 WP_000454713.1.30238 WP_000454713.1.30331 WP_000454713.1.30356 WP_000454713.1.30437 WP_000454713.1.30469 WP_000454713.1.30505 WP_000454713.1.30507 WP_000454713.1.30535 WP_000454713.1.30547 WP_000454713.1.30573 WP_000454713.1.30696 WP_000454713.1.30794 WP_000454713.1.30803 WP_000454713.1.30833 WP_000454713.1.30835 WP_000454713.1.30909 WP_000454713.1.30951 WP_000454713.1.30972 WP_000454713.1.31 WP_000454713.1.31086 WP_000454713.1.31107 WP_000454713.1.31111 WP_000454713.1.3113 WP_000454713.1.31155 WP_000454713.1.31156 WP_000454713.1.31185 WP_000454713.1.3119 WP_000454713.1.31190 WP_000454713.1.31195 WP_000454713.1.31196 WP_000454713.1.31210 WP_000454713.1.31219 WP_000454713.1.31222 WP_000454713.1.31251 WP_000454713.1.31281 WP_000454713.1.31362 WP_000454713.1.31476 WP_000454713.1.31504 WP_000454713.1.31515 WP_000454713.1.31578 WP_000454713.1.31658 WP_000454713.1.31762 WP_000454713.1.31845 WP_000454713.1.31854 WP_000454713.1.31927 WP_000454713.1.31940 WP_000454713.1.31952 WP_000454713.1.31967 WP_000454713.1.31972 WP_000454713.1.32192 WP_000454713.1.32206 WP_000454713.1.32277 WP_000454713.1.32408 WP_000454713.1.32423 WP_000454713.1.32424 WP_000454713.1.32438 WP_000454713.1.32515 WP_000454713.1.32527 WP_000454713.1.32660 WP_000454713.1.32702 WP_000454713.1.32714 WP_000454713.1.32747 WP_000454713.1.3278 WP_000454713.1.32786 WP_000454713.1.32804 WP_000454713.1.32860 WP_000454713.1.32902 WP_000454713.1.32907 WP_000454713.1.32961 WP_000454713.1.33010 WP_000454713.1.33030 WP_000454713.1.33078 WP_000454713.1.33127 WP_000454713.1.33143 WP_000454713.1.33160 WP_000454713.1.33248 WP_000454713.1.33261 WP_000454713.1.333 WP_000454713.1.33492 WP_000454713.1.33499 WP_000454713.1.33553 WP_000454713.1.33592 WP_000454713.1.33609 WP_000454713.1.33629 WP_000454713.1.33659 WP_000454713.1.33817 WP_000454713.1.33894 WP_000454713.1.34043 WP_000454713.1.34075 WP_000454713.1.34084 WP_000454713.1.34257 WP_000454713.1.34259 WP_000454713.1.34279 WP_000454713.1.34319 WP_000454713.1.3445 WP_000454713.1.34453 WP_000454713.1.34610 WP_000454713.1.34659 WP_000454713.1.34667 WP_000454713.1.3476 WP_000454713.1.34817 WP_000454713.1.34856 WP_000454713.1.34881 WP_000454713.1.34975 WP_000454713.1.34977 WP_000454713.1.35045 WP_000454713.1.35129 WP_000454713.1.35184 WP_000454713.1.35404 WP_000454713.1.35408 WP_000454713.1.3541 WP_000454713.1.35425 WP_000454713.1.35429 WP_000454713.1.35446 WP_000454713.1.35463 WP_000454713.1.35503 WP_000454713.1.35509 WP_000454713.1.35590 WP_000454713.1.35777 WP_000454713.1.35835 WP_000454713.1.35868 WP_000454713.1.35940 WP_000454713.1.36003 WP_000454713.1.3601 WP_000454713.1.36011 WP_000454713.1.36157 WP_000454713.1.36229 WP_000454713.1.36542 WP_000454713.1.36609 WP_000454713.1.36690 WP_000454713.1.3670 WP_000454713.1.36705 WP_000454713.1.36751 WP_000454713.1.36885 WP_000454713.1.36899 WP_000454713.1.36918 WP_000454713.1.36931 WP_000454713.1.36949 WP_000454713.1.36978 WP_000454713.1.37021 WP_000454713.1.37063 WP_000454713.1.37073 WP_000454713.1.37111 WP_000454713.1.37112 WP_000454713.1.37147 WP_000454713.1.37158 WP_000454713.1.37190 WP_000454713.1.37256 WP_000454713.1.3728 WP_000454713.1.37293 WP_000454713.1.37320 WP_000454713.1.3734 WP_000454713.1.37370 WP_000454713.1.37376 WP_000454713.1.3744 WP_000454713.1.37498 WP_000454713.1.37504 WP_000454713.1.37558 WP_000454713.1.3756 WP_000454713.1.37610 WP_000454713.1.37618 WP_000454713.1.37687 WP_000454713.1.37968 WP_000454713.1.37978 WP_000454713.1.38001 WP_000454713.1.38055 WP_000454713.1.38113 WP_000454713.1.38125 WP_000454713.1.38145 WP_000454713.1.38199 WP_000454713.1.3828 WP_000454713.1.383 WP_000454713.1.38408 WP_000454713.1.3848 WP_000454713.1.38609 WP_000454713.1.38613 WP_000454713.1.38673 WP_000454713.1.3869 WP_000454713.1.38693 WP_000454713.1.38740 WP_000454713.1.38773 WP_000454713.1.38881 WP_000454713.1.38882 WP_000454713.1.38895 WP_000454713.1.38913 WP_000454713.1.38995 WP_000454713.1.39003 WP_000454713.1.39075 WP_000454713.1.39136 WP_000454713.1.39146 WP_000454713.1.39197 WP_000454713.1.39229 WP_000454713.1.39385 WP_000454713.1.39405 WP_000454713.1.39420 WP_000454713.1.39449 WP_000454713.1.39512 WP_000454713.1.39553 WP_000454713.1.39556 WP_000454713.1.39576 WP_000454713.1.39629 WP_000454713.1.39763 WP_000454713.1.39862 WP_000454713.1.39921 WP_000454713.1.39923 WP_000454713.1.40017 WP_000454713.1.40072 WP_000454713.1.40073 WP_000454713.1.4011 WP_000454713.1.40208 WP_000454713.1.40240 WP_000454713.1.40292 WP_000454713.1.40305 WP_000454713.1.40311 WP_000454713.1.40380 WP_000454713.1.40395 WP_000454713.1.40465 WP_000454713.1.40492 WP_000454713.1.40508 WP_000454713.1.40648 WP_000454713.1.40710 WP_000454713.1.4075 WP_000454713.1.4087 WP_000454713.1.40877 WP_000454713.1.40910 WP_000454713.1.41017 WP_000454713.1.41048 WP_000454713.1.41050 WP_000454713.1.41086 WP_000454713.1.4109 WP_000454713.1.41091 WP_000454713.1.41226 WP_000454713.1.41265 WP_000454713.1.41279 WP_000454713.1.41308 WP_000454713.1.41310 WP_000454713.1.41345 WP_000454713.1.41438 WP_000454713.1.41440 WP_000454713.1.41516 WP_000454713.1.41554 WP_000454713.1.41572 WP_000454713.1.41591 WP_000454713.1.41593 WP_000454713.1.41628 WP_000454713.1.41662 WP_000454713.1.41708 WP_000454713.1.41724 WP_000454713.1.41761 WP_000454713.1.41789 WP_000454713.1.4184 WP_000454713.1.41859 WP_000454713.1.41862 WP_000454713.1.41882 WP_000454713.1.41931 WP_000454713.1.41938 WP_000454713.1.41979 WP_000454713.1.41985 WP_000454713.1.42104 WP_000454713.1.42238 WP_000454713.1.42248 WP_000454713.1.42276 WP_000454713.1.42320 WP_000454713.1.42328 WP_000454713.1.42342 WP_000454713.1.4239 WP_000454713.1.42422 WP_000454713.1.42453 WP_000454713.1.42491 WP_000454713.1.42605 WP_000454713.1.4276 WP_000454713.1.42797 WP_000454713.1.42829 WP_000454713.1.42864 WP_000454713.1.4288 WP_000454713.1.42887 WP_000454713.1.42923 WP_000454713.1.42957 WP_000454713.1.43018 WP_000454713.1.43041 WP_000454713.1.43160 WP_000454713.1.43244 WP_000454713.1.43299 WP_000454713.1.43312 WP_000454713.1.43334 WP_000454713.1.43351 WP_000454713.1.43437 WP_000454713.1.43476 WP_000454713.1.43522 WP_000454713.1.43528 WP_000454713.1.43535 WP_000454713.1.43606 WP_000454713.1.43613 WP_000454713.1.43668 WP_000454713.1.43676 WP_000454713.1.43782 WP_000454713.1.43828 WP_000454713.1.43875 WP_000454713.1.43886 WP_000454713.1.44043 WP_000454713.1.4405 WP_000454713.1.44099 WP_000454713.1.44121 WP_000454713.1.44310 WP_000454713.1.44359 WP_000454713.1.44440 WP_000454713.1.44443 WP_000454713.1.44453 WP_000454713.1.44479 WP_000454713.1.44578 WP_000454713.1.44593 WP_000454713.1.44607 WP_000454713.1.44633 WP_000454713.1.44636 WP_000454713.1.44640 WP_000454713.1.4467 WP_000454713.1.44678 WP_000454713.1.44702 WP_000454713.1.44747 WP_000454713.1.44781 WP_000454713.1.44833 WP_000454713.1.4485 WP_000454713.1.44877 WP_000454713.1.44887 WP_000454713.1.44927 WP_000454713.1.44950 WP_000454713.1.44971 WP_000454713.1.45027 WP_000454713.1.45038 WP_000454713.1.45067 WP_000454713.1.45074 WP_000454713.1.45079 WP_000454713.1.45098 WP_000454713.1.45134 WP_000454713.1.45177 WP_000454713.1.45184 WP_000454713.1.45259 WP_000454713.1.45344 WP_000454713.1.45349 WP_000454713.1.45365 WP_000454713.1.45462 WP_000454713.1.45468 WP_000454713.1.45535 WP_000454713.1.45550 WP_000454713.1.45585 WP_000454713.1.45660 WP_000454713.1.45690 WP_000454713.1.45797 WP_000454713.1.458 WP_000454713.1.46011 WP_000454713.1.46028 WP_000454713.1.46069 WP_000454713.1.46091 WP_000454713.1.46112 WP_000454713.1.46124 WP_000454713.1.46173 WP_000454713.1.46174 WP_000454713.1.46187 WP_000454713.1.46203 WP_000454713.1.46243 WP_000454713.1.46286 WP_000454713.1.46299 WP_000454713.1.46303 WP_000454713.1.46358 WP_000454713.1.46406 WP_000454713.1.46444 WP_000454713.1.46574 WP_000454713.1.46595 WP_000454713.1.46637 WP_000454713.1.46666 WP_000454713.1.46675 WP_000454713.1.4671 WP_000454713.1.46730 WP_000454713.1.46749 WP_000454713.1.46930 WP_000454713.1.46961 WP_000454713.1.47057 WP_000454713.1.47067 WP_000454713.1.47214 WP_000454713.1.47389 WP_000454713.1.47429 WP_000454713.1.47442 WP_000454713.1.47448 WP_000454713.1.47460 WP_000454713.1.4747 WP_000454713.1.47472 WP_000454713.1.47478 WP_000454713.1.47614 WP_000454713.1.47621 WP_000454713.1.47649 WP_000454713.1.47714 WP_000454713.1.4775 WP_000454713.1.47767 WP_000454713.1.47799 WP_000454713.1.47814 WP_000454713.1.47817 WP_000454713.1.47902 WP_000454713.1.47928 WP_000454713.1.48209 WP_000454713.1.48242 WP_000454713.1.48253 WP_000454713.1.483 WP_000454713.1.48367 WP_000454713.1.48377 WP_000454713.1.48493 WP_000454713.1.4853 WP_000454713.1.48570 WP_000454713.1.48751 WP_000454713.1.48774 WP_000454713.1.48788 WP_000454713.1.4885 WP_000454713.1.48876 WP_000454713.1.48886 WP_000454713.1.48894 WP_000454713.1.48919 WP_000454713.1.48985 WP_000454713.1.49005 WP_000454713.1.49084 WP_000454713.1.49102 WP_000454713.1.49155 WP_000454713.1.49175 WP_000454713.1.49204 WP_000454713.1.49214 WP_000454713.1.49226 WP_000454713.1.49233 WP_000454713.1.49239 WP_000454713.1.49256 WP_000454713.1.49290 WP_000454713.1.49304 WP_000454713.1.49340 WP_000454713.1.49366 WP_000454713.1.49472 WP_000454713.1.49490 WP_000454713.1.49515 WP_000454713.1.49572 WP_000454713.1.49574 WP_000454713.1.49626 WP_000454713.1.49647 WP_000454713.1.4979 WP_000454713.1.49803 WP_000454713.1.49805 WP_000454713.1.49848 WP_000454713.1.49929 WP_000454713.1.49931 WP_000454713.1.50003 WP_000454713.1.50007 WP_000454713.1.50080 WP_000454713.1.50161 WP_000454713.1.50198 WP_000454713.1.50211 WP_000454713.1.50285 WP_000454713.1.50374 WP_000454713.1.50376 WP_000454713.1.50389 WP_000454713.1.50413 WP_000454713.1.50469 WP_000454713.1.50563 WP_000454713.1.50565 WP_000454713.1.50576 WP_000454713.1.5058 WP_000454713.1.50593 WP_000454713.1.50676 WP_000454713.1.50774 WP_000454713.1.50800 WP_000454713.1.50804 WP_000454713.1.50808 WP_000454713.1.5088 WP_000454713.1.50908 WP_000454713.1.50941 WP_000454713.1.51014 WP_000454713.1.51022 WP_000454713.1.51036 WP_000454713.1.51117 WP_000454713.1.51131 WP_000454713.1.5114 WP_000454713.1.51162 WP_000454713.1.51179 WP_000454713.1.51182 WP_000454713.1.51186 WP_000454713.1.5125 WP_000454713.1.51285 WP_000454713.1.51308 WP_000454713.1.51331 WP_000454713.1.51414 WP_000454713.1.51464 WP_000454713.1.51487 WP_000454713.1.51488 WP_000454713.1.51514 WP_000454713.1.51555 WP_000454713.1.51594 WP_000454713.1.51611 WP_000454713.1.51634 WP_000454713.1.51649 WP_000454713.1.51686 WP_000454713.1.51700 WP_000454713.1.51704 WP_000454713.1.51756 WP_000454713.1.51841 WP_000454713.1.51888 WP_000454713.1.51910 WP_000454713.1.51911 WP_000454713.1.51932 WP_000454713.1.51989 WP_000454713.1.52047 WP_000454713.1.52121 WP_000454713.1.52123 WP_000454713.1.52148 WP_000454713.1.52346 WP_000454713.1.52353 WP_000454713.1.52361 WP_000454713.1.52438 WP_000454713.1.52528 WP_000454713.1.52653 WP_000454713.1.52656 WP_000454713.1.52743 WP_000454713.1.52748 WP_000454713.1.52851 WP_000454713.1.52857 WP_000454713.1.52898 WP_000454713.1.52915 WP_000454713.1.53100 WP_000454713.1.5316 WP_000454713.1.53190 WP_000454713.1.53206 WP_000454713.1.53315 WP_000454713.1.53406 WP_000454713.1.53436 WP_000454713.1.53466 WP_000454713.1.53529 WP_000454713.1.53534 WP_000454713.1.53543 WP_000454713.1.53675 WP_000454713.1.53688 WP_000454713.1.53694 WP_000454713.1.53696 WP_000454713.1.53757 WP_000454713.1.53772 WP_000454713.1.53812 WP_000454713.1.53814 WP_000454713.1.5392 WP_000454713.1.53935 WP_000454713.1.54033 WP_000454713.1.54061 WP_000454713.1.54075 WP_000454713.1.54082 WP_000454713.1.5415 WP_000454713.1.54196 WP_000454713.1.542 WP_000454713.1.54209 WP_000454713.1.54271 WP_000454713.1.54273 WP_000454713.1.54274 WP_000454713.1.54319 WP_000454713.1.54333 WP_000454713.1.54364 WP_000454713.1.54400 WP_000454713.1.54558 WP_000454713.1.54569 WP_000454713.1.54607 WP_000454713.1.54644 WP_000454713.1.54662 WP_000454713.1.54722 WP_000454713.1.54749 WP_000454713.1.54764 WP_000454713.1.54774 WP_000454713.1.54827 WP_000454713.1.5485 WP_000454713.1.55008 WP_000454713.1.55152 WP_000454713.1.55166 WP_000454713.1.5517 WP_000454713.1.55223 WP_000454713.1.5523 WP_000454713.1.55285 WP_000454713.1.55294 WP_000454713.1.55418 WP_000454713.1.55475 WP_000454713.1.55477 WP_000454713.1.55496 WP_000454713.1.55545 WP_000454713.1.5555 WP_000454713.1.55554 WP_000454713.1.55614 WP_000454713.1.55647 WP_000454713.1.55706 WP_000454713.1.55718 WP_000454713.1.55743 WP_000454713.1.55768 WP_000454713.1.55782 WP_000454713.1.55796 WP_000454713.1.55803 WP_000454713.1.55993 WP_000454713.1.56002 WP_000454713.1.56004 WP_000454713.1.56012 WP_000454713.1.56059 WP_000454713.1.56105 WP_000454713.1.56238 WP_000454713.1.56247 WP_000454713.1.56286 WP_000454713.1.56304 WP_000454713.1.56368 WP_000454713.1.56389 WP_000454713.1.56393 WP_000454713.1.56414 WP_000454713.1.56438 WP_000454713.1.56512 WP_000454713.1.56560 WP_000454713.1.56597 WP_000454713.1.56601 WP_000454713.1.56614 WP_000454713.1.56671 WP_000454713.1.56682 WP_000454713.1.56853 WP_000454713.1.56875 WP_000454713.1.56877 WP_000454713.1.56893 WP_000454713.1.56905 WP_000454713.1.57076 WP_000454713.1.57125 WP_000454713.1.57149 WP_000454713.1.57168 WP_000454713.1.57187 WP_000454713.1.57232 WP_000454713.1.57233 WP_000454713.1.57307 WP_000454713.1.57344 WP_000454713.1.57357 WP_000454713.1.57377 WP_000454713.1.57399 WP_000454713.1.57418 WP_000454713.1.57433 WP_000454713.1.57515 WP_000454713.1.57529 WP_000454713.1.57555 WP_000454713.1.57576 WP_000454713.1.57601 WP_000454713.1.57607 WP_000454713.1.57641 WP_000454713.1.57735 WP_000454713.1.57763 WP_000454713.1.57797 WP_000454713.1.57862 WP_000454713.1.57890 WP_000454713.1.57891 WP_000454713.1.57978 WP_000454713.1.5801 WP_000454713.1.58040 WP_000454713.1.58041 WP_000454713.1.58131 WP_000454713.1.58157 WP_000454713.1.58239 WP_000454713.1.58249 WP_000454713.1.58301 WP_000454713.1.58372 WP_000454713.1.58416 WP_000454713.1.58418 WP_000454713.1.58442 WP_000454713.1.5854 WP_000454713.1.58548 WP_000454713.1.58564 WP_000454713.1.5858 WP_000454713.1.58604 WP_000454713.1.58662 WP_000454713.1.58669 WP_000454713.1.58698 WP_000454713.1.58745 WP_000454713.1.58803 WP_000454713.1.58834 WP_000454713.1.58836 WP_000454713.1.5886 WP_000454713.1.58932 WP_000454713.1.59006 WP_000454713.1.59094 WP_000454713.1.59097 WP_000454713.1.59125 WP_000454713.1.59148 WP_000454713.1.59224 WP_000454713.1.5929 WP_000454713.1.59294 WP_000454713.1.59336 WP_000454713.1.59375 WP_000454713.1.59381 WP_000454713.1.59458 WP_000454713.1.59490 WP_000454713.1.59508 WP_000454713.1.59512 WP_000454713.1.59521 WP_000454713.1.5953 WP_000454713.1.59636 WP_000454713.1.59641 WP_000454713.1.59684 WP_000454713.1.59694 WP_000454713.1.59771 WP_000454713.1.5979 WP_000454713.1.59830 WP_000454713.1.59928 WP_000454713.1.59953 WP_000454713.1.59979 WP_000454713.1.60004 WP_000454713.1.60008 WP_000454713.1.60015 WP_000454713.1.60021 WP_000454713.1.60052 WP_000454713.1.60069 WP_000454713.1.60140 WP_000454713.1.60155 WP_000454713.1.60213 WP_000454713.1.60285 WP_000454713.1.60330 WP_000454713.1.60370 WP_000454713.1.60379 WP_000454713.1.60464 WP_000454713.1.60503 WP_000454713.1.60597 WP_000454713.1.60608 WP_000454713.1.60622 WP_000454713.1.60746 WP_000454713.1.60760 WP_000454713.1.60794 WP_000454713.1.60838 WP_000454713.1.60863 WP_000454713.1.60874 WP_000454713.1.60919 WP_000454713.1.60941 WP_000454713.1.60990 WP_000454713.1.61045 WP_000454713.1.61078 WP_000454713.1.6108 WP_000454713.1.61087 WP_000454713.1.6114 WP_000454713.1.61184 WP_000454713.1.61201 WP_000454713.1.61218 WP_000454713.1.61232 WP_000454713.1.61233 WP_000454713.1.6129 WP_000454713.1.61296 WP_000454713.1.61345 WP_000454713.1.61417 WP_000454713.1.61497 WP_000454713.1.61509 WP_000454713.1.61574 WP_000454713.1.61609 WP_000454713.1.6164 WP_000454713.1.61712 WP_000454713.1.61714 WP_000454713.1.61730 WP_000454713.1.61732 WP_000454713.1.61783 WP_000454713.1.61857 WP_000454713.1.61918 WP_000454713.1.61952 WP_000454713.1.62007 WP_000454713.1.62025 WP_000454713.1.62076 WP_000454713.1.6210 WP_000454713.1.62144 WP_000454713.1.62204 WP_000454713.1.62222 WP_000454713.1.62304 WP_000454713.1.62344 WP_000454713.1.62364 WP_000454713.1.62374 WP_000454713.1.62403 WP_000454713.1.62486 WP_000454713.1.6253 WP_000454713.1.62564 WP_000454713.1.62570 WP_000454713.1.62677 WP_000454713.1.62693 WP_000454713.1.62725 WP_000454713.1.62853 WP_000454713.1.62903 WP_000454713.1.62910 WP_000454713.1.62955 WP_000454713.1.63043 WP_000454713.1.63063 WP_000454713.1.63129 WP_000454713.1.63155 WP_000454713.1.63181 WP_000454713.1.63203 WP_000454713.1.63234 WP_000454713.1.63250 WP_000454713.1.63256 WP_000454713.1.63290 WP_000454713.1.63382 WP_000454713.1.63432 WP_000454713.1.63461 WP_000454713.1.63479 WP_000454713.1.63568 WP_000454713.1.63577 WP_000454713.1.63664 WP_000454713.1.6367 WP_000454713.1.63690 WP_000454713.1.63718 WP_000454713.1.6375 WP_000454713.1.63757 WP_000454713.1.63781 WP_000454713.1.63824 WP_000454713.1.63831 WP_000454713.1.63834 WP_000454713.1.63860 WP_000454713.1.63864 WP_000454713.1.63866 WP_000454713.1.63903 WP_000454713.1.63912 WP_000454713.1.63934 WP_000454713.1.63958 WP_000454713.1.6399 WP_000454713.1.63992 WP_000454713.1.64007 WP_000454713.1.64046 WP_000454713.1.64217 WP_000454713.1.6423 WP_000454713.1.64242 WP_000454713.1.64244 WP_000454713.1.64266 WP_000454713.1.6437 WP_000454713.1.64403 WP_000454713.1.64412 WP_000454713.1.6451 WP_000454713.1.64569 WP_000454713.1.64649 WP_000454713.1.64674 WP_000454713.1.64702 WP_000454713.1.64757 WP_000454713.1.64781 WP_000454713.1.64798 WP_000454713.1.64831 WP_000454713.1.6489 WP_000454713.1.64919 WP_000454713.1.64920 WP_000454713.1.65018 WP_000454713.1.65027 WP_000454713.1.65028 WP_000454713.1.65171 WP_000454713.1.65185 WP_000454713.1.65248 WP_000454713.1.6535 WP_000454713.1.65474 WP_000454713.1.65572 WP_000454713.1.6561 WP_000454713.1.65633 WP_000454713.1.6565 WP_000454713.1.65696 WP_000454713.1.6572 WP_000454713.1.6575 WP_000454713.1.65782 WP_000454713.1.65795 WP_000454713.1.65838 WP_000454713.1.65849 WP_000454713.1.65876 WP_000454713.1.6594 WP_000454713.1.66167 WP_000454713.1.66235 WP_000454713.1.66272 WP_000454713.1.6630 WP_000454713.1.66314 WP_000454713.1.66358 WP_000454713.1.66362 WP_000454713.1.6638 WP_000454713.1.6640 WP_000454713.1.6647 WP_000454713.1.66534 WP_000454713.1.66600 WP_000454713.1.66630 WP_000454713.1.66698 WP_000454713.1.6680 WP_000454713.1.66807 WP_000454713.1.66820 WP_000454713.1.66834 WP_000454713.1.66876 WP_000454713.1.66901 WP_000454713.1.6692 WP_000454713.1.66962 WP_000454713.1.67037 WP_000454713.1.67045 WP_000454713.1.67181 WP_000454713.1.67184 WP_000454713.1.67268 WP_000454713.1.67288 WP_000454713.1.67347 WP_000454713.1.67374 WP_000454713.1.67465 WP_000454713.1.67552 WP_000454713.1.67682 WP_000454713.1.67772 WP_000454713.1.67814 WP_000454713.1.67829 WP_000454713.1.6785 WP_000454713.1.67887 WP_000454713.1.67905 WP_000454713.1.67924 WP_000454713.1.67969 WP_000454713.1.67977 WP_000454713.1.68073 WP_000454713.1.68147 WP_000454713.1.68201 WP_000454713.1.68206 WP_000454713.1.68210 WP_000454713.1.6827 WP_000454713.1.68275 WP_000454713.1.6833 WP_000454713.1.6849 WP_000454713.1.685 WP_000454713.1.68532 WP_000454713.1.68547 WP_000454713.1.68589 WP_000454713.1.68591 WP_000454713.1.68655 WP_000454713.1.68656 WP_000454713.1.6869 WP_000454713.1.68690 WP_000454713.1.68778 WP_000454713.1.68787 WP_000454713.1.68818 WP_000454713.1.6882 WP_000454713.1.68894 WP_000454713.1.68928 WP_000454713.1.68958 WP_000454713.1.68975 WP_000454713.1.68999 WP_000454713.1.69006 WP_000454713.1.6907 WP_000454713.1.6913 WP_000454713.1.69146 WP_000454713.1.69255 WP_000454713.1.69288 WP_000454713.1.69346 WP_000454713.1.69397 WP_000454713.1.69515 WP_000454713.1.69554 WP_000454713.1.69564 WP_000454713.1.69588 WP_000454713.1.69592 WP_000454713.1.69636 WP_000454713.1.69644 WP_000454713.1.69704 WP_000454713.1.69754 WP_000454713.1.69785 WP_000454713.1.69890 WP_000454713.1.70003 WP_000454713.1.7010 WP_000454713.1.7014 WP_000454713.1.7016 WP_000454713.1.70169 WP_000454713.1.7021 WP_000454713.1.70241 WP_000454713.1.70248 WP_000454713.1.70269 WP_000454713.1.70289 WP_000454713.1.70321 WP_000454713.1.70326 WP_000454713.1.70327 WP_000454713.1.70447 WP_000454713.1.70485 WP_000454713.1.70488 WP_000454713.1.70523 WP_000454713.1.70547 WP_000454713.1.70580 WP_000454713.1.70643 WP_000454713.1.70644 WP_000454713.1.70683 WP_000454713.1.70732 WP_000454713.1.70733 WP_000454713.1.70761 WP_000454713.1.70869 WP_000454713.1.70883 WP_000454713.1.70899 WP_000454713.1.70914 WP_000454713.1.70922 WP_000454713.1.70948 WP_000454713.1.71007 WP_000454713.1.71010 WP_000454713.1.71069 WP_000454713.1.7110 WP_000454713.1.71116 WP_000454713.1.71120 WP_000454713.1.71146 WP_000454713.1.71165 WP_000454713.1.71171 WP_000454713.1.71188 WP_000454713.1.71202 WP_000454713.1.71243 WP_000454713.1.71248 WP_000454713.1.71306 WP_000454713.1.71337 WP_000454713.1.7134 WP_000454713.1.71368 WP_000454713.1.71378 WP_000454713.1.714 WP_000454713.1.71401 WP_000454713.1.7142 WP_000454713.1.71446 WP_000454713.1.71481 WP_000454713.1.71691 WP_000454713.1.71702 WP_000454713.1.7174 WP_000454713.1.71746 WP_000454713.1.71750 WP_000454713.1.71756 WP_000454713.1.71845 WP_000454713.1.71881 WP_000454713.1.71908 WP_000454713.1.71941 WP_000454713.1.71952 WP_000454713.1.71973 WP_000454713.1.72065 WP_000454713.1.72068 WP_000454713.1.72105 WP_000454713.1.72107 WP_000454713.1.72203 WP_000454713.1.72220 WP_000454713.1.72226 WP_000454713.1.72243 WP_000454713.1.72307 WP_000454713.1.72351 WP_000454713.1.72372 WP_000454713.1.72376 WP_000454713.1.72382 WP_000454713.1.72594 WP_000454713.1.72689 WP_000454713.1.72793 WP_000454713.1.72827 WP_000454713.1.72843 WP_000454713.1.72850 WP_000454713.1.72871 WP_000454713.1.72887 WP_000454713.1.72892 WP_000454713.1.72968 WP_000454713.1.72975 WP_000454713.1.73062 WP_000454713.1.73144 WP_000454713.1.7315 WP_000454713.1.73200 WP_000454713.1.7334 WP_000454713.1.73377 WP_000454713.1.73481 WP_000454713.1.7356 WP_000454713.1.73561 WP_000454713.1.73581 WP_000454713.1.73596 WP_000454713.1.73617 WP_000454713.1.73667 WP_000454713.1.73669 WP_000454713.1.73753 WP_000454713.1.73758 WP_000454713.1.73794 WP_000454713.1.73831 WP_000454713.1.7386 WP_000454713.1.7387 WP_000454713.1.73901 WP_000454713.1.73924 WP_000454713.1.73926 WP_000454713.1.73956 WP_000454713.1.74029 WP_000454713.1.74040 WP_000454713.1.74089 WP_000454713.1.74117 WP_000454713.1.74181 WP_000454713.1.74191 WP_000454713.1.7433 WP_000454713.1.74379 WP_000454713.1.74402 WP_000454713.1.74410 WP_000454713.1.74418 WP_000454713.1.74454 WP_000454713.1.74466 WP_000454713.1.74529 WP_000454713.1.74545 WP_000454713.1.74620 WP_000454713.1.74639 WP_000454713.1.74745 WP_000454713.1.74806 WP_000454713.1.74992 WP_000454713.1.74996 WP_000454713.1.75129 WP_000454713.1.75180 WP_000454713.1.75187 WP_000454713.1.75288 WP_000454713.1.75301 WP_000454713.1.75334 WP_000454713.1.75362 WP_000454713.1.75385 WP_000454713.1.75392 WP_000454713.1.75402 WP_000454713.1.75703 WP_000454713.1.75740 WP_000454713.1.75760 WP_000454713.1.75764 WP_000454713.1.75793 WP_000454713.1.75828 WP_000454713.1.75837 WP_000454713.1.75873 WP_000454713.1.75874 WP_000454713.1.75884 WP_000454713.1.75945 WP_000454713.1.76020 WP_000454713.1.76024 WP_000454713.1.76055 WP_000454713.1.76097 WP_000454713.1.76102 WP_000454713.1.76156 WP_000454713.1.76170 WP_000454713.1.76208 WP_000454713.1.76252 WP_000454713.1.76301 WP_000454713.1.76364 WP_000454713.1.76445 WP_000454713.1.76471 WP_000454713.1.76532 WP_000454713.1.7660 WP_000454713.1.76673 WP_000454713.1.76706 WP_000454713.1.7672 WP_000454713.1.76721 WP_000454713.1.76738 WP_000454713.1.76756 WP_000454713.1.76760 WP_000454713.1.76799 WP_000454713.1.76806 WP_000454713.1.7684 WP_000454713.1.76875 WP_000454713.1.76880 WP_000454713.1.76899 WP_000454713.1.77038 WP_000454713.1.77047 WP_000454713.1.77080 WP_000454713.1.7712 WP_000454713.1.77180 WP_000454713.1.77184 WP_000454713.1.77241 WP_000454713.1.77244 WP_000454713.1.77271 WP_000454713.1.77292 WP_000454713.1.77349 WP_000454713.1.77414 WP_000454713.1.77436 WP_000454713.1.77514 WP_000454713.1.77529 WP_000454713.1.77543 WP_000454713.1.77549 WP_000454713.1.77565 WP_000454713.1.77596 WP_000454713.1.77653 WP_000454713.1.77692 WP_000454713.1.77754 WP_000454713.1.7782 WP_000454713.1.77851 WP_000454713.1.77898 WP_000454713.1.77918 WP_000454713.1.77960 WP_000454713.1.77971 WP_000454713.1.78033 WP_000454713.1.78076 WP_000454713.1.78096 WP_000454713.1.78100 WP_000454713.1.78110 WP_000454713.1.78120 WP_000454713.1.7814 WP_000454713.1.78201 WP_000454713.1.78245 WP_000454713.1.78383 WP_000454713.1.78407 WP_000454713.1.78495 WP_000454713.1.78496 WP_000454713.1.78602 WP_000454713.1.7861 WP_000454713.1.78618 WP_000454713.1.78673 WP_000454713.1.78735 WP_000454713.1.78771 WP_000454713.1.78802 WP_000454713.1.78830 WP_000454713.1.78835 WP_000454713.1.78871 WP_000454713.1.78874 WP_000454713.1.78881 WP_000454713.1.78913 WP_000454713.1.78918 WP_000454713.1.78928 WP_000454713.1.78930 WP_000454713.1.79011 WP_000454713.1.79032 WP_000454713.1.79151 WP_000454713.1.79167 WP_000454713.1.79203 WP_000454713.1.79302 WP_000454713.1.79335 WP_000454713.1.79370 WP_000454713.1.79427 WP_000454713.1.79462 WP_000454713.1.79466 WP_000454713.1.79472 WP_000454713.1.79490 WP_000454713.1.79495 WP_000454713.1.79529 WP_000454713.1.79570 WP_000454713.1.7964 WP_000454713.1.79642 WP_000454713.1.79645 WP_000454713.1.79659 WP_000454713.1.79668 WP_000454713.1.79708 WP_000454713.1.79845 WP_000454713.1.79867 WP_000454713.1.79914 WP_000454713.1.79929 WP_000454713.1.79934 WP_000454713.1.79951 WP_000454713.1.79966 WP_000454713.1.79974 WP_000454713.1.80077 WP_000454713.1.80137 WP_000454713.1.80182 WP_000454713.1.80236 WP_000454713.1.80296 WP_000454713.1.80307 WP_000454713.1.80366 WP_000454713.1.80443 WP_000454713.1.80473 WP_000454713.1.80479 WP_000454713.1.80480 WP_000454713.1.80529 WP_000454713.1.80542 WP_000454713.1.80586 WP_000454713.1.80629 WP_000454713.1.80667 WP_000454713.1.80674 WP_000454713.1.80750 WP_000454713.1.80780 WP_000454713.1.80827 WP_000454713.1.80831 WP_000454713.1.80850 WP_000454713.1.80857 WP_000454713.1.80868 WP_000454713.1.80881 WP_000454713.1.80959 WP_000454713.1.8096 WP_000454713.1.80973 WP_000454713.1.81037 WP_000454713.1.81069 WP_000454713.1.81107 WP_000454713.1.81149 WP_000454713.1.81175 WP_000454713.1.8119 WP_000454713.1.81193 WP_000454713.1.81275 WP_000454713.1.81302 WP_000454713.1.81321 WP_000454713.1.81354 WP_000454713.1.81410 WP_000454713.1.81425 WP_000454713.1.81667 WP_000454713.1.81736 WP_000454713.1.81743 WP_000454713.1.81750 WP_000454713.1.81785 WP_000454713.1.81795 WP_000454713.1.81902 WP_000454713.1.81974 WP_000454713.1.81977 WP_000454713.1.82037 WP_000454713.1.82337 WP_000454713.1.82395 WP_000454713.1.82479 WP_000454713.1.82503 WP_000454713.1.82515 WP_000454713.1.82529 WP_000454713.1.82570 WP_000454713.1.82584 WP_000454713.1.82648 WP_000454713.1.82676 WP_000454713.1.82761 WP_000454713.1.8282 WP_000454713.1.82841 WP_000454713.1.82867 WP_000454713.1.82895 WP_000454713.1.82937 WP_000454713.1.82944 WP_000454713.1.82956 WP_000454713.1.82992 WP_000454713.1.83061 WP_000454713.1.83092 WP_000454713.1.83119 WP_000454713.1.83128 WP_000454713.1.83163 WP_000454713.1.8322 WP_000454713.1.83258 WP_000454713.1.83305 WP_000454713.1.83365 WP_000454713.1.83407 WP_000454713.1.83413 WP_000454713.1.83491 WP_000454713.1.83516 WP_000454713.1.83523 WP_000454713.1.8354 WP_000454713.1.83650 WP_000454713.1.83651 WP_000454713.1.83710 WP_000454713.1.83721 WP_000454713.1.83759 WP_000454713.1.83760 WP_000454713.1.83854 WP_000454713.1.83960 WP_000454713.1.83979 WP_000454713.1.83995 WP_000454713.1.84001 WP_000454713.1.84100 WP_000454713.1.84103 WP_000454713.1.84198 WP_000454713.1.84209 WP_000454713.1.84283 WP_000454713.1.84355 WP_000454713.1.84392 WP_000454713.1.8441 WP_000454713.1.84532 WP_000454713.1.84554 WP_000454713.1.84659 WP_000454713.1.84683 WP_000454713.1.84693 WP_000454713.1.84711 WP_000454713.1.84745 WP_000454713.1.84899 WP_000454713.1.8497 WP_000454713.1.85040 WP_000454713.1.85120 WP_000454713.1.85126 WP_000454713.1.85134 WP_000454713.1.85178 WP_000454713.1.85180 WP_000454713.1.85190 WP_000454713.1.85217 WP_000454713.1.8533 WP_000454713.1.85408 WP_000454713.1.8545 WP_000454713.1.85481 WP_000454713.1.85483 WP_000454713.1.8552 WP_000454713.1.85541 WP_000454713.1.8556 WP_000454713.1.85615 WP_000454713.1.85617 WP_000454713.1.85663 WP_000454713.1.85671 WP_000454713.1.85672 WP_000454713.1.85723 WP_000454713.1.85742 WP_000454713.1.85777 WP_000454713.1.85784 WP_000454713.1.85855 WP_000454713.1.85886 WP_000454713.1.85900 WP_000454713.1.85904 WP_000454713.1.85943 WP_000454713.1.85976 WP_000454713.1.86010 WP_000454713.1.86284 WP_000454713.1.86306 WP_000454713.1.86316 WP_000454713.1.86335 WP_000454713.1.86356 WP_000454713.1.86389 WP_000454713.1.86450 WP_000454713.1.86453 WP_000454713.1.86469 WP_000454713.1.86580 WP_000454713.1.86588 WP_000454713.1.86601 WP_000454713.1.86656 WP_000454713.1.8672 WP_000454713.1.8678 WP_000454713.1.86807 WP_000454713.1.86810 WP_000454713.1.8684 WP_000454713.1.86860 WP_000454713.1.86895 WP_000454713.1.86906 WP_000454713.1.8691 WP_000454713.1.86982 WP_000454713.1.87095 WP_000454713.1.87143 WP_000454713.1.87148 WP_000454713.1.8722 WP_000454713.1.87282 WP_000454713.1.87283 WP_000454713.1.87323 WP_000454713.1.8736 WP_000454713.1.87460 WP_000454713.1.87552 WP_000454713.1.87779 WP_000454713.1.87875 WP_000454713.1.87933 WP_000454713.1.87945 WP_000454713.1.88019 WP_000454713.1.88073 WP_000454713.1.8809 WP_000454713.1.88214 WP_000454713.1.88264 WP_000454713.1.88291 WP_000454713.1.88293 WP_000454713.1.88303 WP_000454713.1.8837 WP_000454713.1.88393 WP_000454713.1.88651 WP_000454713.1.88683 WP_000454713.1.88698 WP_000454713.1.88703 WP_000454713.1.88762 WP_000454713.1.88792 WP_000454713.1.88845 WP_000454713.1.88902 WP_000454713.1.8891 WP_000454713.1.88970 WP_000454713.1.88981 WP_000454713.1.89008 WP_000454713.1.89116 WP_000454713.1.89138 WP_000454713.1.89291 WP_000454713.1.89304 WP_000454713.1.89452 WP_000454713.1.89512 WP_000454713.1.89527 WP_000454713.1.89570 WP_000454713.1.89604 WP_000454713.1.89622 WP_000454713.1.89632 WP_000454713.1.89659 WP_000454713.1.89902 WP_000454713.1.8996 WP_000454713.1.89965 WP_000454713.1.9002 WP_000454713.1.90097 WP_000454713.1.90193 WP_000454713.1.90211 WP_000454713.1.90252 WP_000454713.1.90311 WP_000454713.1.90409 WP_000454713.1.90417 WP_000454713.1.90453 WP_000454713.1.90458 WP_000454713.1.90557 WP_000454713.1.90585 WP_000454713.1.90641 WP_000454713.1.90686 WP_000454713.1.90701 WP_000454713.1.90734 WP_000454713.1.90866 WP_000454713.1.90984 WP_000454713.1.91003 WP_000454713.1.91069 WP_000454713.1.91278 WP_000454713.1.9131 WP_000454713.1.91334 WP_000454713.1.91470 WP_000454713.1.91493 WP_000454713.1.91512 WP_000454713.1.91524 WP_000454713.1.91564 WP_000454713.1.91580 WP_000454713.1.91655 WP_000454713.1.91724 WP_000454713.1.91732 WP_000454713.1.91736 WP_000454713.1.91788 WP_000454713.1.91864 WP_000454713.1.91880 WP_000454713.1.91903 WP_000454713.1.92013 WP_000454713.1.92044 WP_000454713.1.92047 WP_000454713.1.92060 WP_000454713.1.92067 WP_000454713.1.92093 WP_000454713.1.92099 WP_000454713.1.92108 WP_000454713.1.92171 WP_000454713.1.92183 WP_000454713.1.92208 WP_000454713.1.92268 WP_000454713.1.92310 WP_000454713.1.92318 WP_000454713.1.92394 WP_000454713.1.92439 WP_000454713.1.92443 WP_000454713.1.92482 WP_000454713.1.92529 WP_000454713.1.92531 WP_000454713.1.92562 WP_000454713.1.92669 WP_000454713.1.92671 WP_000454713.1.92729 WP_000454713.1.92738 WP_000454713.1.92758 WP_000454713.1.92827 WP_000454713.1.92895 WP_000454713.1.92975 WP_000454713.1.93061 WP_000454713.1.93086 WP_000454713.1.93101 WP_000454713.1.93136 WP_000454713.1.93155 WP_000454713.1.93213 WP_000454713.1.93275 WP_000454713.1.93322 WP_000454713.1.93365 WP_000454713.1.93376 WP_000454713.1.93543 WP_000454713.1.93596 WP_000454713.1.93650 WP_000454713.1.93656 WP_000454713.1.93662 WP_000454713.1.93691 WP_000454713.1.937 WP_000454713.1.93705 WP_000454713.1.93761 WP_000454713.1.93804 WP_000454713.1.9389 WP_000454713.1.93986 WP_000454713.1.93994 WP_000454713.1.94039 WP_000454713.1.94072 WP_000454713.1.94162 WP_000454713.1.94168 WP_000454713.1.94181 WP_000454713.1.94198 WP_000454713.1.9432 WP_000454713.1.94352 WP_000454713.1.94354 WP_000454713.1.94379 WP_000454713.1.94380 WP_000454713.1.94412 WP_000454713.1.94458 WP_000454713.1.94562 WP_000454713.1.94565 WP_000454713.1.94584 WP_000454713.1.94669 WP_000454713.1.94674 WP_000454713.1.94717 WP_000454713.1.94785 WP_000454713.1.94796 WP_000454713.1.94817 WP_000454713.1.94862 WP_000454713.1.94959 WP_000454713.1.94967 WP_000454713.1.94982 WP_000454713.1.94987 WP_000454713.1.95051 WP_000454713.1.95085 WP_000454713.1.95121 WP_000454713.1.9516 WP_000454713.1.95282 WP_000454713.1.9530 WP_000454713.1.95320 WP_000454713.1.95546 WP_000454713.1.95579 WP_000454713.1.95623 WP_000454713.1.95630 WP_000454713.1.95729 WP_000454713.1.9574 WP_000454713.1.95911 WP_000454713.1.96042 WP_000454713.1.96139 WP_000454713.1.96206 WP_000454713.1.96317 WP_000454713.1.96335 WP_000454713.1.96343 WP_000454713.1.9644 WP_000454713.1.96469 WP_000454713.1.96497 WP_000454713.1.96500 WP_000454713.1.96555 WP_000454713.1.96563 WP_000454713.1.96600 WP_000454713.1.96642 WP_000454713.1.96732 WP_000454713.1.96758 WP_000454713.1.96771 WP_000454713.1.96798 WP_000454713.1.9686 WP_000454713.1.96902 WP_000454713.1.97015 WP_000454713.1.97043 WP_000454713.1.97109 WP_000454713.1.97145 WP_000454713.1.97190 WP_000454713.1.97224 WP_000454713.1.97318 WP_000454713.1.97368 WP_000454713.1.97369 WP_000454713.1.97480 WP_000454713.1.97534 WP_000454713.1.97597 WP_000454713.1.97613 WP_000454713.1.97620 WP_000454713.1.97626 WP_000454713.1.97727 WP_000454713.1.97732 WP_000454713.1.97736 WP_000454713.1.9775 WP_000454713.1.97800 WP_000454713.1.97846 WP_000454713.1.97983 WP_000454713.1.98006 WP_000454713.1.98019 WP_000454713.1.98022 WP_000454713.1.98110 WP_000454713.1.98146 WP_000454713.1.98201 WP_000454713.1.98219 WP_000454713.1.98250 WP_000454713.1.98314 WP_000454713.1.98402 WP_000454713.1.9841 WP_000454713.1.98438 WP_000454713.1.98446 WP_000454713.1.98495 WP_000454713.1.98513 WP_000454713.1.98531 WP_000454713.1.98551 WP_000454713.1.98577 WP_000454713.1.98627 WP_000454713.1.9863 WP_000454713.1.98634 WP_000454713.1.98676 WP_000454713.1.98677 WP_000454713.1.98760 WP_000454713.1.98779 WP_000454713.1.98843 WP_000454713.1.98931 WP_000454713.1.98947 WP_000454713.1.9898 WP_000454713.1.99040 WP_000454713.1.99072 WP_000454713.1.99098 WP_000454713.1.99184 WP_000454713.1.99267 WP_000454713.1.99276 WP_000454713.1.99278 WP_000454713.1.99370 WP_000454713.1.99469 WP_000454713.1.99646 WP_000454713.1.99657 WP_000454713.1.99660 WP_000454713.1.99712 WP_000454713.1.99813 WP_000454713.1.99824 WP_000454713.1.99858 WP_000454713.1.99889 WP_000454713.1.99958 gi|525837748|ref|YP_008254625.1| gi|378989507|ref|YP_005252671.1| gi|379701343|ref|YP_005243071.1| gi|378984682|ref|YP_005247837.1| AE006468|CDS_2203325-2204905 CP000886|CDS_842504-840924 CP001363|CDS_2254878-2256458 FN424405|CDS_2226981-2228561 NZ_ACBF01000014|CDS_14963-16543 gi|378445555|ref|YP_005233187.1| gi|526220705|ref|YP_008266370.1| gi|161613199|ref|YP_001587164.1| 272994.SPAB_00909 99287.STM2119 gi|525946867|ref|YP_008308112.1| gi|482903935|ref|YP_007902495.1| gi|549724785|ref|YP_008644975.1| gi|550901558|ref|YP_008670650.1| gi|513538108|ref|YP_008083630.1| gi|378700032|ref|YP_005181989.1| gi|378450797|ref|YP_005238156.1| GO.170 gi|549479802|ref|YP_008613891.1| gi|528819939|ref|YP_008361142.1| gi|538362741|ref|YP_008506026.1| gi|16765449|ref|NP_461064.1| gi|563653592|ref|YP_008861666.1| gi|525858161|ref|YP_008261401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]