SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16767653|ref|NP_463268.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16767653|ref|NP_463268.1|
Domain Number 1 Region: 344-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.23e-24
Family CorC/HlyC domain-like 0.0000439
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 1.94e-21
Family CBS-domain pair 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16767653|ref|NP_463268.1|
Sequence length 447
Comment hemolysin-like protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
Sequence
MLNSIFIIFCLIAVSAFFSISEISLAASRKIKLKLLADEGSINAQRVLKMQENPGMFFTV
VQIGLNAVAILGGIVGDAAFSPAFSALFSHYMSPELSEQLSFILSFSLVTGLFILFADLT
PKRIGMIAPEAVALRIINPMRFCLFVFRPLVWLFNGMANNIFRLFKIPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESIIWFDLHEDEQSLKKKVAE
HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSMALNSGVQIRNTLIVPDTLTLSEALE
SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLVDGGTP
IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFSGYKFEVVDIDNYRIDQL
LVTRLDNKSNVPAPKLPDAQGKEDSAA
Download sequence
Identical sequences A0A0F6BAS6 A0A0F7JCM3 A0A0H2WW02 A0A0H3NKW9 A0A0M0PU41 A0A0M2IW24 A0A0T7RSD3 A0A0U1FLV8 A0A1S1ASH4 A0A221Z4X4 A0A249V3A9 A0A265B249 A0A2D3AJY9 A0A2G1NQM4 A0A2H9YK34 A0A2K2Z1X8 B5F3D3 C0Q6H7 E8XAT2 G5LI29 G5RPA6 G5SKD1 M7RIV8 Q57GH4 Q7CP89 Q8XG66 V7V440
gi|378987075|ref|YP_005250231.1| gi|378453364|ref|YP_005240724.1| gi|29144706|ref|NP_808048.1| gi|550903743|ref|YP_008672835.1| gi|378962642|ref|YP_005220128.1| gi|378991671|ref|YP_005254835.1| gi|488656893|ref|YP_007928696.1| gi|194451631|ref|YP_002048449.1| 3854 NP_458844.1.84458 NP_463268.1.58477 WP_000934974.1.100007 WP_000934974.1.100008 WP_000934974.1.100010 WP_000934974.1.100017 WP_000934974.1.100036 WP_000934974.1.100079 WP_000934974.1.100115 WP_000934974.1.10013 WP_000934974.1.100196 WP_000934974.1.100234 WP_000934974.1.100258 WP_000934974.1.100284 WP_000934974.1.100313 WP_000934974.1.100314 WP_000934974.1.100321 WP_000934974.1.100354 WP_000934974.1.100376 WP_000934974.1.100421 WP_000934974.1.100424 WP_000934974.1.100432 WP_000934974.1.100436 WP_000934974.1.100446 WP_000934974.1.100450 WP_000934974.1.100484 WP_000934974.1.100488 WP_000934974.1.100584 WP_000934974.1.100589 WP_000934974.1.100592 WP_000934974.1.100597 WP_000934974.1.100610 WP_000934974.1.100650 WP_000934974.1.100721 WP_000934974.1.100730 WP_000934974.1.100732 WP_000934974.1.100733 WP_000934974.1.100739 WP_000934974.1.100750 WP_000934974.1.10076 WP_000934974.1.100764 WP_000934974.1.100781 WP_000934974.1.100790 WP_000934974.1.100793 WP_000934974.1.100799 WP_000934974.1.100869 WP_000934974.1.100870 WP_000934974.1.100871 WP_000934974.1.100882 WP_000934974.1.100932 WP_000934974.1.100941 WP_000934974.1.100948 WP_000934974.1.100953 WP_000934974.1.101007 WP_000934974.1.101011 WP_000934974.1.101020 WP_000934974.1.101074 WP_000934974.1.101078 WP_000934974.1.10108 WP_000934974.1.101111 WP_000934974.1.101126 WP_000934974.1.101180 WP_000934974.1.101223 WP_000934974.1.101226 WP_000934974.1.101239 WP_000934974.1.10124 WP_000934974.1.101259 WP_000934974.1.101271 WP_000934974.1.101284 WP_000934974.1.101291 WP_000934974.1.1013 WP_000934974.1.101312 WP_000934974.1.101320 WP_000934974.1.101322 WP_000934974.1.101353 WP_000934974.1.101374 WP_000934974.1.101386 WP_000934974.1.101404 WP_000934974.1.101454 WP_000934974.1.101589 WP_000934974.1.101616 WP_000934974.1.101636 WP_000934974.1.101707 WP_000934974.1.101724 WP_000934974.1.101734 WP_000934974.1.101740 WP_000934974.1.101841 WP_000934974.1.101878 WP_000934974.1.101890 WP_000934974.1.101904 WP_000934974.1.101927 WP_000934974.1.101941 WP_000934974.1.101953 WP_000934974.1.101975 WP_000934974.1.102009 WP_000934974.1.102050 WP_000934974.1.102087 WP_000934974.1.102103 WP_000934974.1.10220 WP_000934974.1.10231 WP_000934974.1.10266 WP_000934974.1.10338 WP_000934974.1.1038 WP_000934974.1.104 WP_000934974.1.10401 WP_000934974.1.10428 WP_000934974.1.10429 WP_000934974.1.10439 WP_000934974.1.10459 WP_000934974.1.10475 WP_000934974.1.10507 WP_000934974.1.10511 WP_000934974.1.10514 WP_000934974.1.10521 WP_000934974.1.10530 WP_000934974.1.10532 WP_000934974.1.10547 WP_000934974.1.10566 WP_000934974.1.10568 WP_000934974.1.10595 WP_000934974.1.10642 WP_000934974.1.10654 WP_000934974.1.10677 WP_000934974.1.10678 WP_000934974.1.10711 WP_000934974.1.10753 WP_000934974.1.10797 WP_000934974.1.10857 WP_000934974.1.10873 WP_000934974.1.10926 WP_000934974.1.10936 WP_000934974.1.10992 WP_000934974.1.11000 WP_000934974.1.11012 WP_000934974.1.11024 WP_000934974.1.11031 WP_000934974.1.11055 WP_000934974.1.11098 WP_000934974.1.1110 WP_000934974.1.11126 WP_000934974.1.11142 WP_000934974.1.11156 WP_000934974.1.11168 WP_000934974.1.11190 WP_000934974.1.11239 WP_000934974.1.11253 WP_000934974.1.11295 WP_000934974.1.11304 WP_000934974.1.11314 WP_000934974.1.11369 WP_000934974.1.11385 WP_000934974.1.1142 WP_000934974.1.11426 WP_000934974.1.11429 WP_000934974.1.11455 WP_000934974.1.11458 WP_000934974.1.11518 WP_000934974.1.11532 WP_000934974.1.11557 WP_000934974.1.11567 WP_000934974.1.11588 WP_000934974.1.11621 WP_000934974.1.11638 WP_000934974.1.11677 WP_000934974.1.11687 WP_000934974.1.11735 WP_000934974.1.11763 WP_000934974.1.11772 WP_000934974.1.11810 WP_000934974.1.11834 WP_000934974.1.11865 WP_000934974.1.11868 WP_000934974.1.11883 WP_000934974.1.11897 WP_000934974.1.11908 WP_000934974.1.11914 WP_000934974.1.11964 WP_000934974.1.12017 WP_000934974.1.12025 WP_000934974.1.12040 WP_000934974.1.12047 WP_000934974.1.12059 WP_000934974.1.12061 WP_000934974.1.12063 WP_000934974.1.1207 WP_000934974.1.12114 WP_000934974.1.12141 WP_000934974.1.12172 WP_000934974.1.12192 WP_000934974.1.12210 WP_000934974.1.1224 WP_000934974.1.12244 WP_000934974.1.12280 WP_000934974.1.12308 WP_000934974.1.12351 WP_000934974.1.12364 WP_000934974.1.12370 WP_000934974.1.1239 WP_000934974.1.12398 WP_000934974.1.12441 WP_000934974.1.12546 WP_000934974.1.12581 WP_000934974.1.12584 WP_000934974.1.12620 WP_000934974.1.1264 WP_000934974.1.12648 WP_000934974.1.12650 WP_000934974.1.12683 WP_000934974.1.12701 WP_000934974.1.12726 WP_000934974.1.12727 WP_000934974.1.12728 WP_000934974.1.12741 WP_000934974.1.12834 WP_000934974.1.12865 WP_000934974.1.12879 WP_000934974.1.12936 WP_000934974.1.12995 WP_000934974.1.13027 WP_000934974.1.13101 WP_000934974.1.13106 WP_000934974.1.13108 WP_000934974.1.13130 WP_000934974.1.13161 WP_000934974.1.13207 WP_000934974.1.1321 WP_000934974.1.13262 WP_000934974.1.13268 WP_000934974.1.13291 WP_000934974.1.133 WP_000934974.1.13311 WP_000934974.1.13314 WP_000934974.1.13334 WP_000934974.1.13338 WP_000934974.1.13342 WP_000934974.1.13352 WP_000934974.1.13406 WP_000934974.1.13414 WP_000934974.1.13440 WP_000934974.1.13443 WP_000934974.1.13476 WP_000934974.1.13488 WP_000934974.1.13509 WP_000934974.1.13599 WP_000934974.1.13602 WP_000934974.1.13661 WP_000934974.1.13669 WP_000934974.1.13686 WP_000934974.1.1372 WP_000934974.1.13732 WP_000934974.1.13741 WP_000934974.1.1382 WP_000934974.1.13829 WP_000934974.1.13908 WP_000934974.1.13932 WP_000934974.1.13967 WP_000934974.1.13968 WP_000934974.1.1397 WP_000934974.1.13972 WP_000934974.1.140 WP_000934974.1.14001 WP_000934974.1.1401 WP_000934974.1.14041 WP_000934974.1.14050 WP_000934974.1.14056 WP_000934974.1.1408 WP_000934974.1.14089 WP_000934974.1.14099 WP_000934974.1.14111 WP_000934974.1.14120 WP_000934974.1.14123 WP_000934974.1.14150 WP_000934974.1.14151 WP_000934974.1.14191 WP_000934974.1.14197 WP_000934974.1.14212 WP_000934974.1.14239 WP_000934974.1.14280 WP_000934974.1.14286 WP_000934974.1.14320 WP_000934974.1.14333 WP_000934974.1.14379 WP_000934974.1.14399 WP_000934974.1.1440 WP_000934974.1.14406 WP_000934974.1.14410 WP_000934974.1.14436 WP_000934974.1.14444 WP_000934974.1.14446 WP_000934974.1.14458 WP_000934974.1.14466 WP_000934974.1.14467 WP_000934974.1.14500 WP_000934974.1.14505 WP_000934974.1.14516 WP_000934974.1.14519 WP_000934974.1.14524 WP_000934974.1.14526 WP_000934974.1.14528 WP_000934974.1.14550 WP_000934974.1.14554 WP_000934974.1.14575 WP_000934974.1.14618 WP_000934974.1.14701 WP_000934974.1.14703 WP_000934974.1.14719 WP_000934974.1.14725 WP_000934974.1.1473 WP_000934974.1.14737 WP_000934974.1.14765 WP_000934974.1.14808 WP_000934974.1.14810 WP_000934974.1.14852 WP_000934974.1.14876 WP_000934974.1.14877 WP_000934974.1.1489 WP_000934974.1.14894 WP_000934974.1.14930 WP_000934974.1.14932 WP_000934974.1.14947 WP_000934974.1.14948 WP_000934974.1.15011 WP_000934974.1.15046 WP_000934974.1.15055 WP_000934974.1.15079 WP_000934974.1.15124 WP_000934974.1.15184 WP_000934974.1.15214 WP_000934974.1.15223 WP_000934974.1.15226 WP_000934974.1.15244 WP_000934974.1.15265 WP_000934974.1.15316 WP_000934974.1.15362 WP_000934974.1.15369 WP_000934974.1.1540 WP_000934974.1.15415 WP_000934974.1.15423 WP_000934974.1.15433 WP_000934974.1.15439 WP_000934974.1.15468 WP_000934974.1.15479 WP_000934974.1.15487 WP_000934974.1.15508 WP_000934974.1.15535 WP_000934974.1.15581 WP_000934974.1.15597 WP_000934974.1.15612 WP_000934974.1.15627 WP_000934974.1.15637 WP_000934974.1.15710 WP_000934974.1.15717 WP_000934974.1.15784 WP_000934974.1.15830 WP_000934974.1.15835 WP_000934974.1.15862 WP_000934974.1.15905 WP_000934974.1.15909 WP_000934974.1.15910 WP_000934974.1.15912 WP_000934974.1.15922 WP_000934974.1.15938 WP_000934974.1.15970 WP_000934974.1.15978 WP_000934974.1.15986 WP_000934974.1.16004 WP_000934974.1.1601 WP_000934974.1.16046 WP_000934974.1.16047 WP_000934974.1.16051 WP_000934974.1.16052 WP_000934974.1.16058 WP_000934974.1.16062 WP_000934974.1.16063 WP_000934974.1.16103 WP_000934974.1.16125 WP_000934974.1.16150 WP_000934974.1.16155 WP_000934974.1.16158 WP_000934974.1.16226 WP_000934974.1.16233 WP_000934974.1.16244 WP_000934974.1.1626 WP_000934974.1.16264 WP_000934974.1.16284 WP_000934974.1.16328 WP_000934974.1.16344 WP_000934974.1.1635 WP_000934974.1.16361 WP_000934974.1.16452 WP_000934974.1.16461 WP_000934974.1.16462 WP_000934974.1.16465 WP_000934974.1.16468 WP_000934974.1.16522 WP_000934974.1.16525 WP_000934974.1.16551 WP_000934974.1.16588 WP_000934974.1.16614 WP_000934974.1.16650 WP_000934974.1.16656 WP_000934974.1.16658 WP_000934974.1.16666 WP_000934974.1.16673 WP_000934974.1.16691 WP_000934974.1.167 WP_000934974.1.16710 WP_000934974.1.16732 WP_000934974.1.16735 WP_000934974.1.16736 WP_000934974.1.1674 WP_000934974.1.16767 WP_000934974.1.16781 WP_000934974.1.16786 WP_000934974.1.16819 WP_000934974.1.16826 WP_000934974.1.16858 WP_000934974.1.16873 WP_000934974.1.16879 WP_000934974.1.1689 WP_000934974.1.16893 WP_000934974.1.16896 WP_000934974.1.16903 WP_000934974.1.16905 WP_000934974.1.16916 WP_000934974.1.16944 WP_000934974.1.16948 WP_000934974.1.16965 WP_000934974.1.1700 WP_000934974.1.17049 WP_000934974.1.17058 WP_000934974.1.17078 WP_000934974.1.17093 WP_000934974.1.17202 WP_000934974.1.17219 WP_000934974.1.1722 WP_000934974.1.17302 WP_000934974.1.17307 WP_000934974.1.17308 WP_000934974.1.17368 WP_000934974.1.17390 WP_000934974.1.174 WP_000934974.1.17405 WP_000934974.1.17406 WP_000934974.1.17480 WP_000934974.1.17504 WP_000934974.1.17513 WP_000934974.1.17543 WP_000934974.1.17546 WP_000934974.1.17563 WP_000934974.1.1757 WP_000934974.1.17578 WP_000934974.1.17622 WP_000934974.1.17659 WP_000934974.1.17667 WP_000934974.1.17686 WP_000934974.1.17702 WP_000934974.1.17705 WP_000934974.1.17741 WP_000934974.1.17743 WP_000934974.1.17747 WP_000934974.1.17755 WP_000934974.1.17758 WP_000934974.1.17840 WP_000934974.1.17865 WP_000934974.1.17891 WP_000934974.1.17949 WP_000934974.1.17956 WP_000934974.1.1798 WP_000934974.1.18005 WP_000934974.1.1801 WP_000934974.1.18019 WP_000934974.1.18021 WP_000934974.1.18099 WP_000934974.1.18111 WP_000934974.1.18122 WP_000934974.1.18124 WP_000934974.1.18144 WP_000934974.1.18163 WP_000934974.1.18173 WP_000934974.1.1818 WP_000934974.1.18249 WP_000934974.1.1825 WP_000934974.1.18254 WP_000934974.1.18265 WP_000934974.1.18267 WP_000934974.1.18270 WP_000934974.1.18280 WP_000934974.1.18282 WP_000934974.1.18328 WP_000934974.1.18355 WP_000934974.1.18358 WP_000934974.1.18370 WP_000934974.1.18406 WP_000934974.1.18441 WP_000934974.1.18445 WP_000934974.1.18468 WP_000934974.1.18474 WP_000934974.1.18513 WP_000934974.1.18607 WP_000934974.1.18610 WP_000934974.1.18678 WP_000934974.1.18705 WP_000934974.1.18715 WP_000934974.1.18722 WP_000934974.1.18766 WP_000934974.1.18776 WP_000934974.1.1880 WP_000934974.1.18822 WP_000934974.1.1885 WP_000934974.1.18860 WP_000934974.1.18881 WP_000934974.1.18919 WP_000934974.1.18922 WP_000934974.1.18940 WP_000934974.1.18949 WP_000934974.1.18959 WP_000934974.1.18972 WP_000934974.1.19001 WP_000934974.1.19006 WP_000934974.1.19044 WP_000934974.1.19053 WP_000934974.1.19084 WP_000934974.1.19163 WP_000934974.1.19187 WP_000934974.1.19228 WP_000934974.1.19240 WP_000934974.1.19273 WP_000934974.1.19288 WP_000934974.1.19300 WP_000934974.1.19320 WP_000934974.1.19422 WP_000934974.1.19454 WP_000934974.1.19456 WP_000934974.1.19458 WP_000934974.1.19460 WP_000934974.1.19461 WP_000934974.1.19469 WP_000934974.1.19496 WP_000934974.1.19535 WP_000934974.1.19538 WP_000934974.1.19588 WP_000934974.1.19589 WP_000934974.1.19614 WP_000934974.1.19616 WP_000934974.1.19642 WP_000934974.1.19663 WP_000934974.1.1968 WP_000934974.1.19686 WP_000934974.1.19702 WP_000934974.1.19706 WP_000934974.1.19724 WP_000934974.1.19731 WP_000934974.1.19740 WP_000934974.1.19749 WP_000934974.1.19784 WP_000934974.1.19793 WP_000934974.1.19794 WP_000934974.1.19802 WP_000934974.1.19809 WP_000934974.1.19867 WP_000934974.1.19882 WP_000934974.1.1990 WP_000934974.1.1992 WP_000934974.1.19975 WP_000934974.1.1998 WP_000934974.1.19999 WP_000934974.1.20 WP_000934974.1.20023 WP_000934974.1.20034 WP_000934974.1.20081 WP_000934974.1.2010 WP_000934974.1.20119 WP_000934974.1.20212 WP_000934974.1.20254 WP_000934974.1.20255 WP_000934974.1.20266 WP_000934974.1.20271 WP_000934974.1.20296 WP_000934974.1.20330 WP_000934974.1.20339 WP_000934974.1.2036 WP_000934974.1.20362 WP_000934974.1.20415 WP_000934974.1.20418 WP_000934974.1.20419 WP_000934974.1.20443 WP_000934974.1.20446 WP_000934974.1.20465 WP_000934974.1.20488 WP_000934974.1.20492 WP_000934974.1.20525 WP_000934974.1.2053 WP_000934974.1.2054 WP_000934974.1.20553 WP_000934974.1.20564 WP_000934974.1.20614 WP_000934974.1.20626 WP_000934974.1.20635 WP_000934974.1.20646 WP_000934974.1.20718 WP_000934974.1.20721 WP_000934974.1.2073 WP_000934974.1.20740 WP_000934974.1.20767 WP_000934974.1.20789 WP_000934974.1.20795 WP_000934974.1.20828 WP_000934974.1.20862 WP_000934974.1.2087 WP_000934974.1.20883 WP_000934974.1.20886 WP_000934974.1.20900 WP_000934974.1.20908 WP_000934974.1.20947 WP_000934974.1.20953 WP_000934974.1.21010 WP_000934974.1.21049 WP_000934974.1.2106 WP_000934974.1.21062 WP_000934974.1.21136 WP_000934974.1.21144 WP_000934974.1.21146 WP_000934974.1.21162 WP_000934974.1.21184 WP_000934974.1.21185 WP_000934974.1.21245 WP_000934974.1.21246 WP_000934974.1.21269 WP_000934974.1.21351 WP_000934974.1.21366 WP_000934974.1.2139 WP_000934974.1.21400 WP_000934974.1.21404 WP_000934974.1.21453 WP_000934974.1.2146 WP_000934974.1.21492 WP_000934974.1.21497 WP_000934974.1.21499 WP_000934974.1.21534 WP_000934974.1.21548 WP_000934974.1.21603 WP_000934974.1.21616 WP_000934974.1.2166 WP_000934974.1.21674 WP_000934974.1.21751 WP_000934974.1.21757 WP_000934974.1.21946 WP_000934974.1.21966 WP_000934974.1.21991 WP_000934974.1.22024 WP_000934974.1.2205 WP_000934974.1.22062 WP_000934974.1.22064 WP_000934974.1.22067 WP_000934974.1.22118 WP_000934974.1.22126 WP_000934974.1.2216 WP_000934974.1.22208 WP_000934974.1.2221 WP_000934974.1.22235 WP_000934974.1.2224 WP_000934974.1.2227 WP_000934974.1.22270 WP_000934974.1.22337 WP_000934974.1.2235 WP_000934974.1.22373 WP_000934974.1.22379 WP_000934974.1.22427 WP_000934974.1.22451 WP_000934974.1.2246 WP_000934974.1.22476 WP_000934974.1.22485 WP_000934974.1.22537 WP_000934974.1.22566 WP_000934974.1.22582 WP_000934974.1.22590 WP_000934974.1.22614 WP_000934974.1.22620 WP_000934974.1.22623 WP_000934974.1.22652 WP_000934974.1.22683 WP_000934974.1.22692 WP_000934974.1.22758 WP_000934974.1.2284 WP_000934974.1.22845 WP_000934974.1.22864 WP_000934974.1.22870 WP_000934974.1.22895 WP_000934974.1.22926 WP_000934974.1.22943 WP_000934974.1.22967 WP_000934974.1.22979 WP_000934974.1.23040 WP_000934974.1.23058 WP_000934974.1.23080 WP_000934974.1.23102 WP_000934974.1.23114 WP_000934974.1.2314 WP_000934974.1.23172 WP_000934974.1.23192 WP_000934974.1.23218 WP_000934974.1.23258 WP_000934974.1.23259 WP_000934974.1.23309 WP_000934974.1.2331 WP_000934974.1.2332 WP_000934974.1.23340 WP_000934974.1.2336 WP_000934974.1.23365 WP_000934974.1.23379 WP_000934974.1.23412 WP_000934974.1.23426 WP_000934974.1.23460 WP_000934974.1.23466 WP_000934974.1.23472 WP_000934974.1.23482 WP_000934974.1.23492 WP_000934974.1.23509 WP_000934974.1.23515 WP_000934974.1.23548 WP_000934974.1.23604 WP_000934974.1.23621 WP_000934974.1.23634 WP_000934974.1.2364 WP_000934974.1.23643 WP_000934974.1.23646 WP_000934974.1.23670 WP_000934974.1.23675 WP_000934974.1.23679 WP_000934974.1.23685 WP_000934974.1.23707 WP_000934974.1.23728 WP_000934974.1.2375 WP_000934974.1.23755 WP_000934974.1.2376 WP_000934974.1.23783 WP_000934974.1.23786 WP_000934974.1.23787 WP_000934974.1.23801 WP_000934974.1.23932 WP_000934974.1.23959 WP_000934974.1.24017 WP_000934974.1.24028 WP_000934974.1.24061 WP_000934974.1.24082 WP_000934974.1.24083 WP_000934974.1.24117 WP_000934974.1.24125 WP_000934974.1.24138 WP_000934974.1.24153 WP_000934974.1.24163 WP_000934974.1.24206 WP_000934974.1.24291 WP_000934974.1.24308 WP_000934974.1.24322 WP_000934974.1.24325 WP_000934974.1.24355 WP_000934974.1.24375 WP_000934974.1.24392 WP_000934974.1.24394 WP_000934974.1.24400 WP_000934974.1.24420 WP_000934974.1.24433 WP_000934974.1.24444 WP_000934974.1.24578 WP_000934974.1.24619 WP_000934974.1.24643 WP_000934974.1.24688 WP_000934974.1.24696 WP_000934974.1.24716 WP_000934974.1.24737 WP_000934974.1.24779 WP_000934974.1.24803 WP_000934974.1.2481 WP_000934974.1.24832 WP_000934974.1.24837 WP_000934974.1.24964 WP_000934974.1.24995 WP_000934974.1.25008 WP_000934974.1.25015 WP_000934974.1.25017 WP_000934974.1.25032 WP_000934974.1.25036 WP_000934974.1.25041 WP_000934974.1.25053 WP_000934974.1.25072 WP_000934974.1.25119 WP_000934974.1.25140 WP_000934974.1.25185 WP_000934974.1.25196 WP_000934974.1.25205 WP_000934974.1.25206 WP_000934974.1.25210 WP_000934974.1.25219 WP_000934974.1.25304 WP_000934974.1.25374 WP_000934974.1.25405 WP_000934974.1.25421 WP_000934974.1.25454 WP_000934974.1.25475 WP_000934974.1.25490 WP_000934974.1.25493 WP_000934974.1.25498 WP_000934974.1.25508 WP_000934974.1.25512 WP_000934974.1.25514 WP_000934974.1.2554 WP_000934974.1.25603 WP_000934974.1.2562 WP_000934974.1.25666 WP_000934974.1.25668 WP_000934974.1.2568 WP_000934974.1.25690 WP_000934974.1.2570 WP_000934974.1.25700 WP_000934974.1.25709 WP_000934974.1.25722 WP_000934974.1.25740 WP_000934974.1.25793 WP_000934974.1.25807 WP_000934974.1.25814 WP_000934974.1.25821 WP_000934974.1.25833 WP_000934974.1.25835 WP_000934974.1.25846 WP_000934974.1.25882 WP_000934974.1.25911 WP_000934974.1.25928 WP_000934974.1.25962 WP_000934974.1.25963 WP_000934974.1.25988 WP_000934974.1.26001 WP_000934974.1.26027 WP_000934974.1.26030 WP_000934974.1.26107 WP_000934974.1.26122 WP_000934974.1.2615 WP_000934974.1.26199 WP_000934974.1.26217 WP_000934974.1.26230 WP_000934974.1.26232 WP_000934974.1.26272 WP_000934974.1.26282 WP_000934974.1.26286 WP_000934974.1.26311 WP_000934974.1.26319 WP_000934974.1.2634 WP_000934974.1.26384 WP_000934974.1.26394 WP_000934974.1.26429 WP_000934974.1.26440 WP_000934974.1.26491 WP_000934974.1.26493 WP_000934974.1.26532 WP_000934974.1.2654 WP_000934974.1.26551 WP_000934974.1.26554 WP_000934974.1.26567 WP_000934974.1.26587 WP_000934974.1.2660 WP_000934974.1.26636 WP_000934974.1.26689 WP_000934974.1.26741 WP_000934974.1.26750 WP_000934974.1.2679 WP_000934974.1.26856 WP_000934974.1.26882 WP_000934974.1.26883 WP_000934974.1.26908 WP_000934974.1.26919 WP_000934974.1.2692 WP_000934974.1.26928 WP_000934974.1.270 WP_000934974.1.27008 WP_000934974.1.27010 WP_000934974.1.27027 WP_000934974.1.27070 WP_000934974.1.27072 WP_000934974.1.27077 WP_000934974.1.27084 WP_000934974.1.27086 WP_000934974.1.27087 WP_000934974.1.27111 WP_000934974.1.27115 WP_000934974.1.2713 WP_000934974.1.2717 WP_000934974.1.27173 WP_000934974.1.272 WP_000934974.1.27206 WP_000934974.1.27223 WP_000934974.1.27228 WP_000934974.1.2723 WP_000934974.1.27279 WP_000934974.1.27282 WP_000934974.1.27285 WP_000934974.1.27309 WP_000934974.1.27329 WP_000934974.1.27342 WP_000934974.1.27361 WP_000934974.1.27423 WP_000934974.1.27513 WP_000934974.1.27544 WP_000934974.1.27556 WP_000934974.1.27561 WP_000934974.1.27565 WP_000934974.1.27595 WP_000934974.1.27598 WP_000934974.1.27616 WP_000934974.1.2763 WP_000934974.1.27665 WP_000934974.1.27706 WP_000934974.1.27707 WP_000934974.1.27713 WP_000934974.1.27755 WP_000934974.1.27761 WP_000934974.1.27775 WP_000934974.1.27785 WP_000934974.1.27815 WP_000934974.1.27857 WP_000934974.1.27900 WP_000934974.1.27928 WP_000934974.1.27945 WP_000934974.1.27977 WP_000934974.1.28002 WP_000934974.1.28004 WP_000934974.1.28032 WP_000934974.1.2809 WP_000934974.1.28094 WP_000934974.1.28126 WP_000934974.1.28155 WP_000934974.1.28170 WP_000934974.1.28198 WP_000934974.1.2822 WP_000934974.1.28229 WP_000934974.1.2825 WP_000934974.1.28302 WP_000934974.1.2835 WP_000934974.1.28370 WP_000934974.1.28384 WP_000934974.1.28386 WP_000934974.1.28395 WP_000934974.1.284 WP_000934974.1.2845 WP_000934974.1.28479 WP_000934974.1.28504 WP_000934974.1.28514 WP_000934974.1.28538 WP_000934974.1.28575 WP_000934974.1.28625 WP_000934974.1.28627 WP_000934974.1.28655 WP_000934974.1.28692 WP_000934974.1.28694 WP_000934974.1.2873 WP_000934974.1.2879 WP_000934974.1.28811 WP_000934974.1.2890 WP_000934974.1.28917 WP_000934974.1.28946 WP_000934974.1.28948 WP_000934974.1.28962 WP_000934974.1.28977 WP_000934974.1.29006 WP_000934974.1.29010 WP_000934974.1.29023 WP_000934974.1.29042 WP_000934974.1.2905 WP_000934974.1.2907 WP_000934974.1.29081 WP_000934974.1.29089 WP_000934974.1.29099 WP_000934974.1.2910 WP_000934974.1.29113 WP_000934974.1.29130 WP_000934974.1.29153 WP_000934974.1.29174 WP_000934974.1.29203 WP_000934974.1.29237 WP_000934974.1.29248 WP_000934974.1.29255 WP_000934974.1.29274 WP_000934974.1.29288 WP_000934974.1.29349 WP_000934974.1.29389 WP_000934974.1.29439 WP_000934974.1.2946 WP_000934974.1.29462 WP_000934974.1.29509 WP_000934974.1.29563 WP_000934974.1.29588 WP_000934974.1.29601 WP_000934974.1.29606 WP_000934974.1.29615 WP_000934974.1.29619 WP_000934974.1.29704 WP_000934974.1.29727 WP_000934974.1.29732 WP_000934974.1.29743 WP_000934974.1.29782 WP_000934974.1.29827 WP_000934974.1.29833 WP_000934974.1.2984 WP_000934974.1.29845 WP_000934974.1.29851 WP_000934974.1.29865 WP_000934974.1.29886 WP_000934974.1.29898 WP_000934974.1.29919 WP_000934974.1.29923 WP_000934974.1.29924 WP_000934974.1.2994 WP_000934974.1.29964 WP_000934974.1.29969 WP_000934974.1.29983 WP_000934974.1.29990 WP_000934974.1.30006 WP_000934974.1.30009 WP_000934974.1.30013 WP_000934974.1.3002 WP_000934974.1.30022 WP_000934974.1.30027 WP_000934974.1.30034 WP_000934974.1.30049 WP_000934974.1.30058 WP_000934974.1.30093 WP_000934974.1.30172 WP_000934974.1.30180 WP_000934974.1.30185 WP_000934974.1.30195 WP_000934974.1.30202 WP_000934974.1.30246 WP_000934974.1.30331 WP_000934974.1.30354 WP_000934974.1.30357 WP_000934974.1.30362 WP_000934974.1.3042 WP_000934974.1.30421 WP_000934974.1.30437 WP_000934974.1.30440 WP_000934974.1.30448 WP_000934974.1.30469 WP_000934974.1.30489 WP_000934974.1.30505 WP_000934974.1.30507 WP_000934974.1.30517 WP_000934974.1.30535 WP_000934974.1.30542 WP_000934974.1.30544 WP_000934974.1.30547 WP_000934974.1.30555 WP_000934974.1.30556 WP_000934974.1.30572 WP_000934974.1.30573 WP_000934974.1.30585 WP_000934974.1.30618 WP_000934974.1.30619 WP_000934974.1.30664 WP_000934974.1.3067 WP_000934974.1.3068 WP_000934974.1.30688 WP_000934974.1.30696 WP_000934974.1.30794 WP_000934974.1.30806 WP_000934974.1.30833 WP_000934974.1.30835 WP_000934974.1.30967 WP_000934974.1.30972 WP_000934974.1.31 WP_000934974.1.31046 WP_000934974.1.31066 WP_000934974.1.31069 WP_000934974.1.31078 WP_000934974.1.31086 WP_000934974.1.31092 WP_000934974.1.31107 WP_000934974.1.31122 WP_000934974.1.3113 WP_000934974.1.31139 WP_000934974.1.3114 WP_000934974.1.31145 WP_000934974.1.31155 WP_000934974.1.31171 WP_000934974.1.31182 WP_000934974.1.31185 WP_000934974.1.3119 WP_000934974.1.31190 WP_000934974.1.31195 WP_000934974.1.31196 WP_000934974.1.31205 WP_000934974.1.3121 WP_000934974.1.31219 WP_000934974.1.31223 WP_000934974.1.31251 WP_000934974.1.3127 WP_000934974.1.31281 WP_000934974.1.31303 WP_000934974.1.3131 WP_000934974.1.31352 WP_000934974.1.31362 WP_000934974.1.31389 WP_000934974.1.31413 WP_000934974.1.31446 WP_000934974.1.31451 WP_000934974.1.31504 WP_000934974.1.31515 WP_000934974.1.31533 WP_000934974.1.31546 WP_000934974.1.31578 WP_000934974.1.31658 WP_000934974.1.31665 WP_000934974.1.31720 WP_000934974.1.31762 WP_000934974.1.31799 WP_000934974.1.31836 WP_000934974.1.31845 WP_000934974.1.31854 WP_000934974.1.31940 WP_000934974.1.31951 WP_000934974.1.31952 WP_000934974.1.31967 WP_000934974.1.31972 WP_000934974.1.31983 WP_000934974.1.32041 WP_000934974.1.32042 WP_000934974.1.3207 WP_000934974.1.32189 WP_000934974.1.32192 WP_000934974.1.32202 WP_000934974.1.32206 WP_000934974.1.32260 WP_000934974.1.32263 WP_000934974.1.32293 WP_000934974.1.32299 WP_000934974.1.32408 WP_000934974.1.32422 WP_000934974.1.32425 WP_000934974.1.32438 WP_000934974.1.32458 WP_000934974.1.32460 WP_000934974.1.32491 WP_000934974.1.32493 WP_000934974.1.32515 WP_000934974.1.32527 WP_000934974.1.32529 WP_000934974.1.32563 WP_000934974.1.32578 WP_000934974.1.32617 WP_000934974.1.32660 WP_000934974.1.3270 WP_000934974.1.32702 WP_000934974.1.32714 WP_000934974.1.32725 WP_000934974.1.32747 WP_000934974.1.3278 WP_000934974.1.32786 WP_000934974.1.32804 WP_000934974.1.32838 WP_000934974.1.32848 WP_000934974.1.32860 WP_000934974.1.32868 WP_000934974.1.329 WP_000934974.1.3290 WP_000934974.1.32902 WP_000934974.1.32907 WP_000934974.1.32940 WP_000934974.1.32941 WP_000934974.1.3296 WP_000934974.1.32966 WP_000934974.1.32985 WP_000934974.1.33030 WP_000934974.1.33037 WP_000934974.1.3305 WP_000934974.1.33051 WP_000934974.1.33065 WP_000934974.1.33078 WP_000934974.1.33106 WP_000934974.1.33122 WP_000934974.1.33127 WP_000934974.1.33143 WP_000934974.1.3315 WP_000934974.1.33160 WP_000934974.1.33208 WP_000934974.1.33214 WP_000934974.1.33247 WP_000934974.1.33248 WP_000934974.1.33261 WP_000934974.1.33280 WP_000934974.1.33283 WP_000934974.1.333 WP_000934974.1.33313 WP_000934974.1.33339 WP_000934974.1.33382 WP_000934974.1.33420 WP_000934974.1.33490 WP_000934974.1.33492 WP_000934974.1.33501 WP_000934974.1.33504 WP_000934974.1.33529 WP_000934974.1.33553 WP_000934974.1.33580 WP_000934974.1.33592 WP_000934974.1.33609 WP_000934974.1.33689 WP_000934974.1.3370 WP_000934974.1.33730 WP_000934974.1.33741 WP_000934974.1.33817 WP_000934974.1.33825 WP_000934974.1.33840 WP_000934974.1.33865 WP_000934974.1.33894 WP_000934974.1.3392 WP_000934974.1.33926 WP_000934974.1.3394 WP_000934974.1.3395 WP_000934974.1.33957 WP_000934974.1.33969 WP_000934974.1.33986 WP_000934974.1.34001 WP_000934974.1.34043 WP_000934974.1.34059 WP_000934974.1.34075 WP_000934974.1.34084 WP_000934974.1.34118 WP_000934974.1.34211 WP_000934974.1.34214 WP_000934974.1.34234 WP_000934974.1.34257 WP_000934974.1.34279 WP_000934974.1.34284 WP_000934974.1.34319 WP_000934974.1.34376 WP_000934974.1.34382 WP_000934974.1.34417 WP_000934974.1.34424 WP_000934974.1.3445 WP_000934974.1.34453 WP_000934974.1.34458 WP_000934974.1.34484 WP_000934974.1.34517 WP_000934974.1.34530 WP_000934974.1.34610 WP_000934974.1.34665 WP_000934974.1.34667 WP_000934974.1.34684 WP_000934974.1.34694 WP_000934974.1.34751 WP_000934974.1.3476 WP_000934974.1.34808 WP_000934974.1.34824 WP_000934974.1.34834 WP_000934974.1.34854 WP_000934974.1.34856 WP_000934974.1.34881 WP_000934974.1.34932 WP_000934974.1.34962 WP_000934974.1.34972 WP_000934974.1.34975 WP_000934974.1.34977 WP_000934974.1.35001 WP_000934974.1.35040 WP_000934974.1.35045 WP_000934974.1.35074 WP_000934974.1.35129 WP_000934974.1.35175 WP_000934974.1.35184 WP_000934974.1.35193 WP_000934974.1.35240 WP_000934974.1.35274 WP_000934974.1.35331 WP_000934974.1.35332 WP_000934974.1.35404 WP_000934974.1.35408 WP_000934974.1.35425 WP_000934974.1.35429 WP_000934974.1.35446 WP_000934974.1.35463 WP_000934974.1.35503 WP_000934974.1.35507 WP_000934974.1.35509 WP_000934974.1.35532 WP_000934974.1.35560 WP_000934974.1.3557 WP_000934974.1.35590 WP_000934974.1.35619 WP_000934974.1.35628 WP_000934974.1.3566 WP_000934974.1.3570 WP_000934974.1.35712 WP_000934974.1.35713 WP_000934974.1.3572 WP_000934974.1.35736 WP_000934974.1.35791 WP_000934974.1.35795 WP_000934974.1.35835 WP_000934974.1.35870 WP_000934974.1.35892 WP_000934974.1.35916 WP_000934974.1.35938 WP_000934974.1.35940 WP_000934974.1.35966 WP_000934974.1.36000 WP_000934974.1.36003 WP_000934974.1.3601 WP_000934974.1.36017 WP_000934974.1.36034 WP_000934974.1.36036 WP_000934974.1.36057 WP_000934974.1.36069 WP_000934974.1.36229 WP_000934974.1.36291 WP_000934974.1.36298 WP_000934974.1.36308 WP_000934974.1.36323 WP_000934974.1.36343 WP_000934974.1.36460 WP_000934974.1.3649 WP_000934974.1.36495 WP_000934974.1.36547 WP_000934974.1.36567 WP_000934974.1.36579 WP_000934974.1.36586 WP_000934974.1.36609 WP_000934974.1.36617 WP_000934974.1.36618 WP_000934974.1.36643 WP_000934974.1.36663 WP_000934974.1.36690 WP_000934974.1.3670 WP_000934974.1.36701 WP_000934974.1.36705 WP_000934974.1.36725 WP_000934974.1.36751 WP_000934974.1.36779 WP_000934974.1.36798 WP_000934974.1.36802 WP_000934974.1.36821 WP_000934974.1.36853 WP_000934974.1.36875 WP_000934974.1.36885 WP_000934974.1.36918 WP_000934974.1.36931 WP_000934974.1.36948 WP_000934974.1.36950 WP_000934974.1.36978 WP_000934974.1.37014 WP_000934974.1.37021 WP_000934974.1.37063 WP_000934974.1.37073 WP_000934974.1.37111 WP_000934974.1.37112 WP_000934974.1.37133 WP_000934974.1.37147 WP_000934974.1.37158 WP_000934974.1.37176 WP_000934974.1.37190 WP_000934974.1.37199 WP_000934974.1.37200 WP_000934974.1.37256 WP_000934974.1.37258 WP_000934974.1.3726 WP_000934974.1.3728 WP_000934974.1.37293 WP_000934974.1.37303 WP_000934974.1.37351 WP_000934974.1.37370 WP_000934974.1.37376 WP_000934974.1.3744 WP_000934974.1.37478 WP_000934974.1.37498 WP_000934974.1.37504 WP_000934974.1.37513 WP_000934974.1.37521 WP_000934974.1.3756 WP_000934974.1.37584 WP_000934974.1.37590 WP_000934974.1.37593 WP_000934974.1.37600 WP_000934974.1.37613 WP_000934974.1.37618 WP_000934974.1.37659 WP_000934974.1.37662 WP_000934974.1.37675 WP_000934974.1.37687 WP_000934974.1.37691 WP_000934974.1.37761 WP_000934974.1.37775 WP_000934974.1.37777 WP_000934974.1.378 WP_000934974.1.379 WP_000934974.1.37911 WP_000934974.1.37941 WP_000934974.1.37968 WP_000934974.1.37978 WP_000934974.1.37985 WP_000934974.1.38001 WP_000934974.1.38026 WP_000934974.1.38055 WP_000934974.1.38061 WP_000934974.1.38064 WP_000934974.1.38108 WP_000934974.1.38113 WP_000934974.1.38125 WP_000934974.1.38145 WP_000934974.1.3816 WP_000934974.1.38207 WP_000934974.1.38261 WP_000934974.1.38266 WP_000934974.1.3828 WP_000934974.1.383 WP_000934974.1.3834 WP_000934974.1.38351 WP_000934974.1.3838 WP_000934974.1.38381 WP_000934974.1.38393 WP_000934974.1.38440 WP_000934974.1.38452 WP_000934974.1.3848 WP_000934974.1.38486 WP_000934974.1.38515 WP_000934974.1.38569 WP_000934974.1.38595 WP_000934974.1.3860 WP_000934974.1.38613 WP_000934974.1.38620 WP_000934974.1.38642 WP_000934974.1.38673 WP_000934974.1.3869 WP_000934974.1.38693 WP_000934974.1.38734 WP_000934974.1.38773 WP_000934974.1.38781 WP_000934974.1.38877 WP_000934974.1.38881 WP_000934974.1.38882 WP_000934974.1.38895 WP_000934974.1.3891 WP_000934974.1.38913 WP_000934974.1.38983 WP_000934974.1.38995 WP_000934974.1.38996 WP_000934974.1.39003 WP_000934974.1.39056 WP_000934974.1.3907 WP_000934974.1.39105 WP_000934974.1.39112 WP_000934974.1.39136 WP_000934974.1.3914 WP_000934974.1.39147 WP_000934974.1.39161 WP_000934974.1.39197 WP_000934974.1.39210 WP_000934974.1.39229 WP_000934974.1.39235 WP_000934974.1.39265 WP_000934974.1.3931 WP_000934974.1.39385 WP_000934974.1.39405 WP_000934974.1.39414 WP_000934974.1.39420 WP_000934974.1.39435 WP_000934974.1.39449 WP_000934974.1.39497 WP_000934974.1.39502 WP_000934974.1.39512 WP_000934974.1.39530 WP_000934974.1.39556 WP_000934974.1.39584 WP_000934974.1.39609 WP_000934974.1.39614 WP_000934974.1.39619 WP_000934974.1.39620 WP_000934974.1.39624 WP_000934974.1.39629 WP_000934974.1.39659 WP_000934974.1.39667 WP_000934974.1.39723 WP_000934974.1.39724 WP_000934974.1.39763 WP_000934974.1.39775 WP_000934974.1.39862 WP_000934974.1.39879 WP_000934974.1.39890 WP_000934974.1.39921 WP_000934974.1.39923 WP_000934974.1.39941 WP_000934974.1.39945 WP_000934974.1.39947 WP_000934974.1.39953 WP_000934974.1.40017 WP_000934974.1.40031 WP_000934974.1.40072 WP_000934974.1.40073 WP_000934974.1.40095 WP_000934974.1.40097 WP_000934974.1.401 WP_000934974.1.4011 WP_000934974.1.40158 WP_000934974.1.40160 WP_000934974.1.40167 WP_000934974.1.40170 WP_000934974.1.40208 WP_000934974.1.40224 WP_000934974.1.40229 WP_000934974.1.40240 WP_000934974.1.40257 WP_000934974.1.40258 WP_000934974.1.40279 WP_000934974.1.40284 WP_000934974.1.40292 WP_000934974.1.40305 WP_000934974.1.40311 WP_000934974.1.40341 WP_000934974.1.40361 WP_000934974.1.40380 WP_000934974.1.40395 WP_000934974.1.4042 WP_000934974.1.40465 WP_000934974.1.40467 WP_000934974.1.40496 WP_000934974.1.40508 WP_000934974.1.40517 WP_000934974.1.40688 WP_000934974.1.40698 WP_000934974.1.40710 WP_000934974.1.4075 WP_000934974.1.40750 WP_000934974.1.40763 WP_000934974.1.40771 WP_000934974.1.40854 WP_000934974.1.4087 WP_000934974.1.40877 WP_000934974.1.4089 WP_000934974.1.40910 WP_000934974.1.40924 WP_000934974.1.40932 WP_000934974.1.40935 WP_000934974.1.40946 WP_000934974.1.40996 WP_000934974.1.41004 WP_000934974.1.41017 WP_000934974.1.41018 WP_000934974.1.4106 WP_000934974.1.41070 WP_000934974.1.41074 WP_000934974.1.41075 WP_000934974.1.41086 WP_000934974.1.4109 WP_000934974.1.41091 WP_000934974.1.41097 WP_000934974.1.41132 WP_000934974.1.41176 WP_000934974.1.41226 WP_000934974.1.41251 WP_000934974.1.41258 WP_000934974.1.41265 WP_000934974.1.41279 WP_000934974.1.41305 WP_000934974.1.41308 WP_000934974.1.41310 WP_000934974.1.41321 WP_000934974.1.41333 WP_000934974.1.41335 WP_000934974.1.41345 WP_000934974.1.4136 WP_000934974.1.4141 WP_000934974.1.41415 WP_000934974.1.41434 WP_000934974.1.41440 WP_000934974.1.41459 WP_000934974.1.41498 WP_000934974.1.41516 WP_000934974.1.41519 WP_000934974.1.41524 WP_000934974.1.41554 WP_000934974.1.41572 WP_000934974.1.41591 WP_000934974.1.41593 WP_000934974.1.41628 WP_000934974.1.41631 WP_000934974.1.41658 WP_000934974.1.41659 WP_000934974.1.41662 WP_000934974.1.41708 WP_000934974.1.41716 WP_000934974.1.41724 WP_000934974.1.41746 WP_000934974.1.41761 WP_000934974.1.41824 WP_000934974.1.41825 WP_000934974.1.41836 WP_000934974.1.4184 WP_000934974.1.41859 WP_000934974.1.41877 WP_000934974.1.41882 WP_000934974.1.41894 WP_000934974.1.41919 WP_000934974.1.41929 WP_000934974.1.4194 WP_000934974.1.41979 WP_000934974.1.41985 WP_000934974.1.41998 WP_000934974.1.42009 WP_000934974.1.42069 WP_000934974.1.42081 WP_000934974.1.42090 WP_000934974.1.42098 WP_000934974.1.42104 WP_000934974.1.42111 WP_000934974.1.42156 WP_000934974.1.42187 WP_000934974.1.42200 WP_000934974.1.42219 WP_000934974.1.4222 WP_000934974.1.42243 WP_000934974.1.42257 WP_000934974.1.42261 WP_000934974.1.4229 WP_000934974.1.42320 WP_000934974.1.42342 WP_000934974.1.42349 WP_000934974.1.42364 WP_000934974.1.42371 WP_000934974.1.42372 WP_000934974.1.42379 WP_000934974.1.4239 WP_000934974.1.42391 WP_000934974.1.42399 WP_000934974.1.42422 WP_000934974.1.42444 WP_000934974.1.42453 WP_000934974.1.42489 WP_000934974.1.42539 WP_000934974.1.4257 WP_000934974.1.42603 WP_000934974.1.42650 WP_000934974.1.4267 WP_000934974.1.42676 WP_000934974.1.42701 WP_000934974.1.4276 WP_000934974.1.42767 WP_000934974.1.42805 WP_000934974.1.42815 WP_000934974.1.42859 WP_000934974.1.42861 WP_000934974.1.42864 WP_000934974.1.4288 WP_000934974.1.42957 WP_000934974.1.4298 WP_000934974.1.43008 WP_000934974.1.43016 WP_000934974.1.43018 WP_000934974.1.43019 WP_000934974.1.43041 WP_000934974.1.43065 WP_000934974.1.43068 WP_000934974.1.43069 WP_000934974.1.43077 WP_000934974.1.43086 WP_000934974.1.43128 WP_000934974.1.43141 WP_000934974.1.43157 WP_000934974.1.43161 WP_000934974.1.43190 WP_000934974.1.43198 WP_000934974.1.43244 WP_000934974.1.4326 WP_000934974.1.43276 WP_000934974.1.43290 WP_000934974.1.43292 WP_000934974.1.43307 WP_000934974.1.43312 WP_000934974.1.43334 WP_000934974.1.43339 WP_000934974.1.43351 WP_000934974.1.43371 WP_000934974.1.43437 WP_000934974.1.43441 WP_000934974.1.43508 WP_000934974.1.43513 WP_000934974.1.43522 WP_000934974.1.43528 WP_000934974.1.43613 WP_000934974.1.43633 WP_000934974.1.43637 WP_000934974.1.43651 WP_000934974.1.43668 WP_000934974.1.43676 WP_000934974.1.43722 WP_000934974.1.4373 WP_000934974.1.43778 WP_000934974.1.43782 WP_000934974.1.43801 WP_000934974.1.43812 WP_000934974.1.43828 WP_000934974.1.43878 WP_000934974.1.43886 WP_000934974.1.43888 WP_000934974.1.43919 WP_000934974.1.43951 WP_000934974.1.43974 WP_000934974.1.44005 WP_000934974.1.44043 WP_000934974.1.44049 WP_000934974.1.44099 WP_000934974.1.44101 WP_000934974.1.44113 WP_000934974.1.44121 WP_000934974.1.44144 WP_000934974.1.44160 WP_000934974.1.44180 WP_000934974.1.44196 WP_000934974.1.44248 WP_000934974.1.44262 WP_000934974.1.44268 WP_000934974.1.4427 WP_000934974.1.44291 WP_000934974.1.44296 WP_000934974.1.44300 WP_000934974.1.44310 WP_000934974.1.44343 WP_000934974.1.44351 WP_000934974.1.44359 WP_000934974.1.44360 WP_000934974.1.44386 WP_000934974.1.44397 WP_000934974.1.44416 WP_000934974.1.44431 WP_000934974.1.44433 WP_000934974.1.44437 WP_000934974.1.44438 WP_000934974.1.44453 WP_000934974.1.44479 WP_000934974.1.44546 WP_000934974.1.44578 WP_000934974.1.44606 WP_000934974.1.44607 WP_000934974.1.44636 WP_000934974.1.44640 WP_000934974.1.4467 WP_000934974.1.4468 WP_000934974.1.44687 WP_000934974.1.44747 WP_000934974.1.44762 WP_000934974.1.44815 WP_000934974.1.44828 WP_000934974.1.4485 WP_000934974.1.44877 WP_000934974.1.44879 WP_000934974.1.449 WP_000934974.1.44917 WP_000934974.1.44927 WP_000934974.1.44933 WP_000934974.1.44943 WP_000934974.1.44971 WP_000934974.1.4501 WP_000934974.1.45045 WP_000934974.1.4505 WP_000934974.1.45067 WP_000934974.1.45072 WP_000934974.1.45074 WP_000934974.1.45079 WP_000934974.1.45093 WP_000934974.1.45098 WP_000934974.1.45134 WP_000934974.1.45136 WP_000934974.1.45145 WP_000934974.1.45177 WP_000934974.1.45184 WP_000934974.1.45241 WP_000934974.1.45259 WP_000934974.1.45344 WP_000934974.1.45349 WP_000934974.1.45365 WP_000934974.1.4540 WP_000934974.1.45434 WP_000934974.1.45435 WP_000934974.1.45522 WP_000934974.1.45523 WP_000934974.1.45535 WP_000934974.1.45550 WP_000934974.1.45582 WP_000934974.1.45585 WP_000934974.1.45596 WP_000934974.1.45622 WP_000934974.1.45648 WP_000934974.1.45660 WP_000934974.1.45690 WP_000934974.1.45781 WP_000934974.1.45797 WP_000934974.1.458 WP_000934974.1.45829 WP_000934974.1.45848 WP_000934974.1.45871 WP_000934974.1.4592 WP_000934974.1.46011 WP_000934974.1.46028 WP_000934974.1.46030 WP_000934974.1.46069 WP_000934974.1.46077 WP_000934974.1.46112 WP_000934974.1.46124 WP_000934974.1.46169 WP_000934974.1.46173 WP_000934974.1.46174 WP_000934974.1.46187 WP_000934974.1.46203 WP_000934974.1.46205 WP_000934974.1.46225 WP_000934974.1.46241 WP_000934974.1.46278 WP_000934974.1.46286 WP_000934974.1.46303 WP_000934974.1.46307 WP_000934974.1.46322 WP_000934974.1.46323 WP_000934974.1.46355 WP_000934974.1.46358 WP_000934974.1.464 WP_000934974.1.46434 WP_000934974.1.46454 WP_000934974.1.46461 WP_000934974.1.46504 WP_000934974.1.46505 WP_000934974.1.46551 WP_000934974.1.46559 WP_000934974.1.46572 WP_000934974.1.46574 WP_000934974.1.46595 WP_000934974.1.46637 WP_000934974.1.46666 WP_000934974.1.46675 WP_000934974.1.46701 WP_000934974.1.46749 WP_000934974.1.46781 WP_000934974.1.46816 WP_000934974.1.46842 WP_000934974.1.4690 WP_000934974.1.46920 WP_000934974.1.46930 WP_000934974.1.46945 WP_000934974.1.47008 WP_000934974.1.47023 WP_000934974.1.47036 WP_000934974.1.47037 WP_000934974.1.47042 WP_000934974.1.47057 WP_000934974.1.47059 WP_000934974.1.47061 WP_000934974.1.47067 WP_000934974.1.47085 WP_000934974.1.47110 WP_000934974.1.47123 WP_000934974.1.47214 WP_000934974.1.47215 WP_000934974.1.47243 WP_000934974.1.47245 WP_000934974.1.47389 WP_000934974.1.47429 WP_000934974.1.47448 WP_000934974.1.47460 WP_000934974.1.4747 WP_000934974.1.47472 WP_000934974.1.47478 WP_000934974.1.47506 WP_000934974.1.47523 WP_000934974.1.47531 WP_000934974.1.47532 WP_000934974.1.47542 WP_000934974.1.47579 WP_000934974.1.47605 WP_000934974.1.47614 WP_000934974.1.47621 WP_000934974.1.47630 WP_000934974.1.47649 WP_000934974.1.47660 WP_000934974.1.4770 WP_000934974.1.47714 WP_000934974.1.4774 WP_000934974.1.4775 WP_000934974.1.47756 WP_000934974.1.47767 WP_000934974.1.47799 WP_000934974.1.4781 WP_000934974.1.47814 WP_000934974.1.47817 WP_000934974.1.47886 WP_000934974.1.47898 WP_000934974.1.47928 WP_000934974.1.47992 WP_000934974.1.48019 WP_000934974.1.48100 WP_000934974.1.48114 WP_000934974.1.48134 WP_000934974.1.48139 WP_000934974.1.48190 WP_000934974.1.48209 WP_000934974.1.48242 WP_000934974.1.48253 WP_000934974.1.48268 WP_000934974.1.48292 WP_000934974.1.483 WP_000934974.1.48324 WP_000934974.1.48367 WP_000934974.1.48377 WP_000934974.1.48426 WP_000934974.1.48430 WP_000934974.1.48436 WP_000934974.1.48510 WP_000934974.1.4853 WP_000934974.1.48570 WP_000934974.1.48586 WP_000934974.1.4859 WP_000934974.1.48591 WP_000934974.1.48610 WP_000934974.1.48631 WP_000934974.1.48663 WP_000934974.1.48690 WP_000934974.1.48734 WP_000934974.1.48751 WP_000934974.1.48755 WP_000934974.1.48756 WP_000934974.1.48768 WP_000934974.1.48778 WP_000934974.1.48788 WP_000934974.1.48841 WP_000934974.1.48849 WP_000934974.1.4885 WP_000934974.1.48855 WP_000934974.1.48876 WP_000934974.1.48886 WP_000934974.1.48894 WP_000934974.1.48919 WP_000934974.1.48955 WP_000934974.1.48963 WP_000934974.1.48973 WP_000934974.1.48985 WP_000934974.1.49004 WP_000934974.1.49012 WP_000934974.1.49084 WP_000934974.1.49106 WP_000934974.1.49113 WP_000934974.1.49117 WP_000934974.1.49121 WP_000934974.1.4914 WP_000934974.1.49140 WP_000934974.1.49153 WP_000934974.1.49155 WP_000934974.1.49166 WP_000934974.1.49175 WP_000934974.1.49204 WP_000934974.1.49214 WP_000934974.1.49233 WP_000934974.1.49239 WP_000934974.1.49256 WP_000934974.1.49276 WP_000934974.1.49290 WP_000934974.1.49304 WP_000934974.1.49309 WP_000934974.1.49340 WP_000934974.1.49355 WP_000934974.1.49366 WP_000934974.1.49429 WP_000934974.1.49430 WP_000934974.1.49434 WP_000934974.1.49450 WP_000934974.1.49472 WP_000934974.1.49490 WP_000934974.1.49494 WP_000934974.1.495 WP_000934974.1.49515 WP_000934974.1.49545 WP_000934974.1.49572 WP_000934974.1.49686 WP_000934974.1.49703 WP_000934974.1.49769 WP_000934974.1.4979 WP_000934974.1.49790 WP_000934974.1.49803 WP_000934974.1.49805 WP_000934974.1.49827 WP_000934974.1.49846 WP_000934974.1.4991 WP_000934974.1.49929 WP_000934974.1.49947 WP_000934974.1.49959 WP_000934974.1.49997 WP_000934974.1.50014 WP_000934974.1.50030 WP_000934974.1.50043 WP_000934974.1.50080 WP_000934974.1.50103 WP_000934974.1.50153 WP_000934974.1.50158 WP_000934974.1.50161 WP_000934974.1.50211 WP_000934974.1.50247 WP_000934974.1.50251 WP_000934974.1.50285 WP_000934974.1.50308 WP_000934974.1.50309 WP_000934974.1.50374 WP_000934974.1.50376 WP_000934974.1.50387 WP_000934974.1.50389 WP_000934974.1.50404 WP_000934974.1.50406 WP_000934974.1.50468 WP_000934974.1.50469 WP_000934974.1.50497 WP_000934974.1.5051 WP_000934974.1.50529 WP_000934974.1.50563 WP_000934974.1.50566 WP_000934974.1.50570 WP_000934974.1.50626 WP_000934974.1.50676 WP_000934974.1.50726 WP_000934974.1.50750 WP_000934974.1.50771 WP_000934974.1.50774 WP_000934974.1.50777 WP_000934974.1.50782 WP_000934974.1.50804 WP_000934974.1.50808 WP_000934974.1.50875 WP_000934974.1.5088 WP_000934974.1.50885 WP_000934974.1.509 WP_000934974.1.50905 WP_000934974.1.50908 WP_000934974.1.50929 WP_000934974.1.50941 WP_000934974.1.50970 WP_000934974.1.51014 WP_000934974.1.51022 WP_000934974.1.51036 WP_000934974.1.51040 WP_000934974.1.51048 WP_000934974.1.51066 WP_000934974.1.51100 WP_000934974.1.51134 WP_000934974.1.5114 WP_000934974.1.51179 WP_000934974.1.51182 WP_000934974.1.51186 WP_000934974.1.51224 WP_000934974.1.51227 WP_000934974.1.5125 WP_000934974.1.5127 WP_000934974.1.51305 WP_000934974.1.51315 WP_000934974.1.5136 WP_000934974.1.51414 WP_000934974.1.51464 WP_000934974.1.51474 WP_000934974.1.51487 WP_000934974.1.51488 WP_000934974.1.51519 WP_000934974.1.51594 WP_000934974.1.51598 WP_000934974.1.51634 WP_000934974.1.51644 WP_000934974.1.51649 WP_000934974.1.51686 WP_000934974.1.51704 WP_000934974.1.51724 WP_000934974.1.51734 WP_000934974.1.51756 WP_000934974.1.51831 WP_000934974.1.51838 WP_000934974.1.51841 WP_000934974.1.5185 WP_000934974.1.51863 WP_000934974.1.51910 WP_000934974.1.51911 WP_000934974.1.51932 WP_000934974.1.51935 WP_000934974.1.51989 WP_000934974.1.52047 WP_000934974.1.52057 WP_000934974.1.52101 WP_000934974.1.52114 WP_000934974.1.52121 WP_000934974.1.52129 WP_000934974.1.52148 WP_000934974.1.52156 WP_000934974.1.52170 WP_000934974.1.52191 WP_000934974.1.52202 WP_000934974.1.52209 WP_000934974.1.52255 WP_000934974.1.52336 WP_000934974.1.52339 WP_000934974.1.52346 WP_000934974.1.52353 WP_000934974.1.52361 WP_000934974.1.52438 WP_000934974.1.52469 WP_000934974.1.52571 WP_000934974.1.526 WP_000934974.1.52647 WP_000934974.1.52653 WP_000934974.1.52656 WP_000934974.1.52692 WP_000934974.1.52742 WP_000934974.1.52743 WP_000934974.1.52744 WP_000934974.1.52748 WP_000934974.1.52773 WP_000934974.1.52795 WP_000934974.1.52807 WP_000934974.1.52851 WP_000934974.1.52857 WP_000934974.1.52866 WP_000934974.1.52887 WP_000934974.1.52898 WP_000934974.1.52915 WP_000934974.1.52924 WP_000934974.1.52949 WP_000934974.1.52985 WP_000934974.1.53092 WP_000934974.1.53141 WP_000934974.1.53151 WP_000934974.1.53154 WP_000934974.1.53159 WP_000934974.1.5316 WP_000934974.1.53190 WP_000934974.1.53206 WP_000934974.1.53210 WP_000934974.1.53233 WP_000934974.1.53272 WP_000934974.1.53286 WP_000934974.1.53307 WP_000934974.1.53315 WP_000934974.1.53321 WP_000934974.1.53368 WP_000934974.1.53375 WP_000934974.1.53406 WP_000934974.1.53436 WP_000934974.1.53450 WP_000934974.1.53466 WP_000934974.1.5349 WP_000934974.1.53529 WP_000934974.1.53540 WP_000934974.1.53543 WP_000934974.1.53555 WP_000934974.1.53559 WP_000934974.1.5356 WP_000934974.1.53571 WP_000934974.1.5358 WP_000934974.1.53688 WP_000934974.1.53692 WP_000934974.1.53723 WP_000934974.1.5374 WP_000934974.1.53750 WP_000934974.1.53757 WP_000934974.1.53800 WP_000934974.1.53812 WP_000934974.1.53814 WP_000934974.1.53815 WP_000934974.1.53839 WP_000934974.1.53892 WP_000934974.1.53898 WP_000934974.1.53902 WP_000934974.1.53905 WP_000934974.1.5392 WP_000934974.1.53935 WP_000934974.1.53958 WP_000934974.1.53981 WP_000934974.1.53984 WP_000934974.1.54033 WP_000934974.1.54075 WP_000934974.1.54132 WP_000934974.1.54136 WP_000934974.1.5415 WP_000934974.1.54170 WP_000934974.1.54175 WP_000934974.1.54196 WP_000934974.1.542 WP_000934974.1.54203 WP_000934974.1.54209 WP_000934974.1.54259 WP_000934974.1.54271 WP_000934974.1.54273 WP_000934974.1.54274 WP_000934974.1.5430 WP_000934974.1.54319 WP_000934974.1.54340 WP_000934974.1.54364 WP_000934974.1.54371 WP_000934974.1.54400 WP_000934974.1.54431 WP_000934974.1.54442 WP_000934974.1.54469 WP_000934974.1.54482 WP_000934974.1.54522 WP_000934974.1.5456 WP_000934974.1.54569 WP_000934974.1.54589 WP_000934974.1.5462 WP_000934974.1.54644 WP_000934974.1.54662 WP_000934974.1.54667 WP_000934974.1.54678 WP_000934974.1.54681 WP_000934974.1.54722 WP_000934974.1.54748 WP_000934974.1.54749 WP_000934974.1.54764 WP_000934974.1.5481 WP_000934974.1.54814 WP_000934974.1.54845 WP_000934974.1.54865 WP_000934974.1.54935 WP_000934974.1.54979 WP_000934974.1.54992 WP_000934974.1.55008 WP_000934974.1.55010 WP_000934974.1.55034 WP_000934974.1.55073 WP_000934974.1.55152 WP_000934974.1.55156 WP_000934974.1.55163 WP_000934974.1.55165 WP_000934974.1.55166 WP_000934974.1.55178 WP_000934974.1.55200 WP_000934974.1.55215 WP_000934974.1.55223 WP_000934974.1.5523 WP_000934974.1.5527 WP_000934974.1.55285 WP_000934974.1.55290 WP_000934974.1.55310 WP_000934974.1.55317 WP_000934974.1.55325 WP_000934974.1.55379 WP_000934974.1.5539 WP_000934974.1.55418 WP_000934974.1.55430 WP_000934974.1.55468 WP_000934974.1.55475 WP_000934974.1.55477 WP_000934974.1.55496 WP_000934974.1.55506 WP_000934974.1.5555 WP_000934974.1.55557 WP_000934974.1.5560 WP_000934974.1.55604 WP_000934974.1.55639 WP_000934974.1.55647 WP_000934974.1.55699 WP_000934974.1.55706 WP_000934974.1.55718 WP_000934974.1.55725 WP_000934974.1.55743 WP_000934974.1.55768 WP_000934974.1.55780 WP_000934974.1.55782 WP_000934974.1.55796 WP_000934974.1.55803 WP_000934974.1.55853 WP_000934974.1.55967 WP_000934974.1.55973 WP_000934974.1.55993 WP_000934974.1.56002 WP_000934974.1.56004 WP_000934974.1.56012 WP_000934974.1.56026 WP_000934974.1.56070 WP_000934974.1.56082 WP_000934974.1.56105 WP_000934974.1.56144 WP_000934974.1.56172 WP_000934974.1.5621 WP_000934974.1.56226 WP_000934974.1.56238 WP_000934974.1.56244 WP_000934974.1.56261 WP_000934974.1.56286 WP_000934974.1.56304 WP_000934974.1.56311 WP_000934974.1.56368 WP_000934974.1.56414 WP_000934974.1.56419 WP_000934974.1.56423 WP_000934974.1.56438 WP_000934974.1.56514 WP_000934974.1.56535 WP_000934974.1.56559 WP_000934974.1.56560 WP_000934974.1.56597 WP_000934974.1.56601 WP_000934974.1.56614 WP_000934974.1.56640 WP_000934974.1.56647 WP_000934974.1.56660 WP_000934974.1.56671 WP_000934974.1.56682 WP_000934974.1.56724 WP_000934974.1.56791 WP_000934974.1.56825 WP_000934974.1.56853 WP_000934974.1.56875 WP_000934974.1.56877 WP_000934974.1.56887 WP_000934974.1.56889 WP_000934974.1.56893 WP_000934974.1.56942 WP_000934974.1.56950 WP_000934974.1.56981 WP_000934974.1.57000 WP_000934974.1.57076 WP_000934974.1.57084 WP_000934974.1.57101 WP_000934974.1.57125 WP_000934974.1.57137 WP_000934974.1.57147 WP_000934974.1.57168 WP_000934974.1.57179 WP_000934974.1.57186 WP_000934974.1.57187 WP_000934974.1.57232 WP_000934974.1.57244 WP_000934974.1.57307 WP_000934974.1.57342 WP_000934974.1.57344 WP_000934974.1.57356 WP_000934974.1.57377 WP_000934974.1.57418 WP_000934974.1.57433 WP_000934974.1.57515 WP_000934974.1.57521 WP_000934974.1.57529 WP_000934974.1.57534 WP_000934974.1.57576 WP_000934974.1.57601 WP_000934974.1.57607 WP_000934974.1.5761 WP_000934974.1.57641 WP_000934974.1.57684 WP_000934974.1.57699 WP_000934974.1.57735 WP_000934974.1.57763 WP_000934974.1.57785 WP_000934974.1.57800 WP_000934974.1.57873 WP_000934974.1.57890 WP_000934974.1.57891 WP_000934974.1.57902 WP_000934974.1.57965 WP_000934974.1.57972 WP_000934974.1.57978 WP_000934974.1.58008 WP_000934974.1.5801 WP_000934974.1.58040 WP_000934974.1.58041 WP_000934974.1.58044 WP_000934974.1.58081 WP_000934974.1.5809 WP_000934974.1.58131 WP_000934974.1.58132 WP_000934974.1.58144 WP_000934974.1.58157 WP_000934974.1.58173 WP_000934974.1.58191 WP_000934974.1.58194 WP_000934974.1.58239 WP_000934974.1.58252 WP_000934974.1.58261 WP_000934974.1.58274 WP_000934974.1.58282 WP_000934974.1.58324 WP_000934974.1.58326 WP_000934974.1.58358 WP_000934974.1.5836 WP_000934974.1.58407 WP_000934974.1.58416 WP_000934974.1.58418 WP_000934974.1.58442 WP_000934974.1.58451 WP_000934974.1.58467 WP_000934974.1.58485 WP_000934974.1.58537 WP_000934974.1.5854 WP_000934974.1.58548 WP_000934974.1.58568 WP_000934974.1.5858 WP_000934974.1.58652 WP_000934974.1.58662 WP_000934974.1.58663 WP_000934974.1.58669 WP_000934974.1.58724 WP_000934974.1.58745 WP_000934974.1.58749 WP_000934974.1.5875 WP_000934974.1.5878 WP_000934974.1.58796 WP_000934974.1.58803 WP_000934974.1.58807 WP_000934974.1.58831 WP_000934974.1.58836 WP_000934974.1.58847 WP_000934974.1.5886 WP_000934974.1.58861 WP_000934974.1.58883 WP_000934974.1.58898 WP_000934974.1.58932 WP_000934974.1.58949 WP_000934974.1.58963 WP_000934974.1.58970 WP_000934974.1.58974 WP_000934974.1.59006 WP_000934974.1.59020 WP_000934974.1.59043 WP_000934974.1.59056 WP_000934974.1.59061 WP_000934974.1.59064 WP_000934974.1.59068 WP_000934974.1.59084 WP_000934974.1.59094 WP_000934974.1.59097 WP_000934974.1.59125 WP_000934974.1.59224 WP_000934974.1.59276 WP_000934974.1.59282 WP_000934974.1.5929 WP_000934974.1.59299 WP_000934974.1.59313 WP_000934974.1.59321 WP_000934974.1.59335 WP_000934974.1.59336 WP_000934974.1.59375 WP_000934974.1.59381 WP_000934974.1.59420 WP_000934974.1.59458 WP_000934974.1.5949 WP_000934974.1.59490 WP_000934974.1.59501 WP_000934974.1.59508 WP_000934974.1.59510 WP_000934974.1.59512 WP_000934974.1.5953 WP_000934974.1.59641 WP_000934974.1.59684 WP_000934974.1.5969 WP_000934974.1.59694 WP_000934974.1.59751 WP_000934974.1.59771 WP_000934974.1.5979 WP_000934974.1.59827 WP_000934974.1.59829 WP_000934974.1.59830 WP_000934974.1.59847 WP_000934974.1.59863 WP_000934974.1.59953 WP_000934974.1.59969 WP_000934974.1.59979 WP_000934974.1.59994 WP_000934974.1.60004 WP_000934974.1.60008 WP_000934974.1.60021 WP_000934974.1.60045 WP_000934974.1.60052 WP_000934974.1.60069 WP_000934974.1.60076 WP_000934974.1.60106 WP_000934974.1.60114 WP_000934974.1.60140 WP_000934974.1.60154 WP_000934974.1.60155 WP_000934974.1.60168 WP_000934974.1.60192 WP_000934974.1.60199 WP_000934974.1.60209 WP_000934974.1.60212 WP_000934974.1.60253 WP_000934974.1.60285 WP_000934974.1.60322 WP_000934974.1.60324 WP_000934974.1.60356 WP_000934974.1.60379 WP_000934974.1.6038 WP_000934974.1.60380 WP_000934974.1.6041 WP_000934974.1.60424 WP_000934974.1.60464 WP_000934974.1.60481 WP_000934974.1.60486 WP_000934974.1.605 WP_000934974.1.60503 WP_000934974.1.60545 WP_000934974.1.60561 WP_000934974.1.6058 WP_000934974.1.60584 WP_000934974.1.6060 WP_000934974.1.60608 WP_000934974.1.60622 WP_000934974.1.60676 WP_000934974.1.60708 WP_000934974.1.60725 WP_000934974.1.60760 WP_000934974.1.60772 WP_000934974.1.60783 WP_000934974.1.60792 WP_000934974.1.60794 WP_000934974.1.60807 WP_000934974.1.60809 WP_000934974.1.60855 WP_000934974.1.60863 WP_000934974.1.60874 WP_000934974.1.60882 WP_000934974.1.60889 WP_000934974.1.60919 WP_000934974.1.60941 WP_000934974.1.60950 WP_000934974.1.6104 WP_000934974.1.61044 WP_000934974.1.61076 WP_000934974.1.61078 WP_000934974.1.6108 WP_000934974.1.61123 WP_000934974.1.6114 WP_000934974.1.61146 WP_000934974.1.61147 WP_000934974.1.61168 WP_000934974.1.61210 WP_000934974.1.61232 WP_000934974.1.6129 WP_000934974.1.61296 WP_000934974.1.61309 WP_000934974.1.61345 WP_000934974.1.61357 WP_000934974.1.61417 WP_000934974.1.6143 WP_000934974.1.61497 WP_000934974.1.61509 WP_000934974.1.61511 WP_000934974.1.61539 WP_000934974.1.61542 WP_000934974.1.61553 WP_000934974.1.61574 WP_000934974.1.61609 WP_000934974.1.6164 WP_000934974.1.61649 WP_000934974.1.61652 WP_000934974.1.61694 WP_000934974.1.61697 WP_000934974.1.61712 WP_000934974.1.61714 WP_000934974.1.61730 WP_000934974.1.61732 WP_000934974.1.61809 WP_000934974.1.61857 WP_000934974.1.61877 WP_000934974.1.61918 WP_000934974.1.61920 WP_000934974.1.61924 WP_000934974.1.61952 WP_000934974.1.62007 WP_000934974.1.62020 WP_000934974.1.62025 WP_000934974.1.62063 WP_000934974.1.62076 WP_000934974.1.62124 WP_000934974.1.62144 WP_000934974.1.62195 WP_000934974.1.62199 WP_000934974.1.62204 WP_000934974.1.62222 WP_000934974.1.62223 WP_000934974.1.62245 WP_000934974.1.62257 WP_000934974.1.62271 WP_000934974.1.62302 WP_000934974.1.62304 WP_000934974.1.62314 WP_000934974.1.62323 WP_000934974.1.62333 WP_000934974.1.62338 WP_000934974.1.62339 WP_000934974.1.62364 WP_000934974.1.62374 WP_000934974.1.62380 WP_000934974.1.62403 WP_000934974.1.62404 WP_000934974.1.62411 WP_000934974.1.62436 WP_000934974.1.62475 WP_000934974.1.62504 WP_000934974.1.6253 WP_000934974.1.62536 WP_000934974.1.62570 WP_000934974.1.62640 WP_000934974.1.62686 WP_000934974.1.62693 WP_000934974.1.62751 WP_000934974.1.62825 WP_000934974.1.62853 WP_000934974.1.62903 WP_000934974.1.62910 WP_000934974.1.62913 WP_000934974.1.62932 WP_000934974.1.62955 WP_000934974.1.62960 WP_000934974.1.63016 WP_000934974.1.63025 WP_000934974.1.63063 WP_000934974.1.63069 WP_000934974.1.63087 WP_000934974.1.63129 WP_000934974.1.63169 WP_000934974.1.63181 WP_000934974.1.63186 WP_000934974.1.63203 WP_000934974.1.63250 WP_000934974.1.63256 WP_000934974.1.63290 WP_000934974.1.63297 WP_000934974.1.63382 WP_000934974.1.63422 WP_000934974.1.63432 WP_000934974.1.63448 WP_000934974.1.63461 WP_000934974.1.63479 WP_000934974.1.63514 WP_000934974.1.63525 WP_000934974.1.63568 WP_000934974.1.63577 WP_000934974.1.63583 WP_000934974.1.63592 WP_000934974.1.63663 WP_000934974.1.63664 WP_000934974.1.63690 WP_000934974.1.63718 WP_000934974.1.63736 WP_000934974.1.6375 WP_000934974.1.63757 WP_000934974.1.63766 WP_000934974.1.63781 WP_000934974.1.63797 WP_000934974.1.63816 WP_000934974.1.63834 WP_000934974.1.63860 WP_000934974.1.63866 WP_000934974.1.63876 WP_000934974.1.6389 WP_000934974.1.63901 WP_000934974.1.63903 WP_000934974.1.63912 WP_000934974.1.63934 WP_000934974.1.63955 WP_000934974.1.63958 WP_000934974.1.63963 WP_000934974.1.6399 WP_000934974.1.64007 WP_000934974.1.64018 WP_000934974.1.64032 WP_000934974.1.64046 WP_000934974.1.64087 WP_000934974.1.64121 WP_000934974.1.6415 WP_000934974.1.64217 WP_000934974.1.6423 WP_000934974.1.64244 WP_000934974.1.64293 WP_000934974.1.64332 WP_000934974.1.64376 WP_000934974.1.64387 WP_000934974.1.644 WP_000934974.1.64403 WP_000934974.1.64412 WP_000934974.1.64471 WP_000934974.1.64501 WP_000934974.1.6451 WP_000934974.1.64538 WP_000934974.1.64632 WP_000934974.1.64648 WP_000934974.1.64649 WP_000934974.1.64654 WP_000934974.1.64662 WP_000934974.1.64663 WP_000934974.1.64674 WP_000934974.1.64690 WP_000934974.1.64702 WP_000934974.1.64709 WP_000934974.1.64710 WP_000934974.1.64744 WP_000934974.1.64757 WP_000934974.1.64758 WP_000934974.1.64763 WP_000934974.1.64781 WP_000934974.1.64817 WP_000934974.1.64831 WP_000934974.1.64847 WP_000934974.1.6487 WP_000934974.1.6489 WP_000934974.1.64891 WP_000934974.1.64894 WP_000934974.1.64974 WP_000934974.1.64977 WP_000934974.1.65016 WP_000934974.1.65018 WP_000934974.1.65027 WP_000934974.1.65028 WP_000934974.1.65052 WP_000934974.1.65054 WP_000934974.1.65075 WP_000934974.1.6514 WP_000934974.1.65171 WP_000934974.1.65172 WP_000934974.1.65185 WP_000934974.1.65191 WP_000934974.1.65200 WP_000934974.1.65211 WP_000934974.1.65218 WP_000934974.1.65226 WP_000934974.1.65248 WP_000934974.1.65249 WP_000934974.1.65266 WP_000934974.1.65269 WP_000934974.1.6535 WP_000934974.1.65394 WP_000934974.1.65395 WP_000934974.1.65459 WP_000934974.1.65463 WP_000934974.1.65474 WP_000934974.1.65475 WP_000934974.1.65487 WP_000934974.1.6549 WP_000934974.1.65499 WP_000934974.1.6554 WP_000934974.1.65572 WP_000934974.1.65633 WP_000934974.1.6565 WP_000934974.1.65650 WP_000934974.1.65696 WP_000934974.1.65697 WP_000934974.1.65699 WP_000934974.1.65737 WP_000934974.1.6575 WP_000934974.1.65755 WP_000934974.1.65782 WP_000934974.1.65790 WP_000934974.1.65812 WP_000934974.1.65818 WP_000934974.1.65846 WP_000934974.1.65863 WP_000934974.1.65876 WP_000934974.1.6594 WP_000934974.1.65940 WP_000934974.1.65945 WP_000934974.1.65956 WP_000934974.1.65985 WP_000934974.1.66021 WP_000934974.1.66031 WP_000934974.1.66049 WP_000934974.1.66052 WP_000934974.1.66064 WP_000934974.1.66074 WP_000934974.1.66109 WP_000934974.1.66122 WP_000934974.1.66145 WP_000934974.1.66183 WP_000934974.1.6620 WP_000934974.1.66216 WP_000934974.1.66234 WP_000934974.1.66273 WP_000934974.1.66289 WP_000934974.1.6630 WP_000934974.1.66314 WP_000934974.1.66324 WP_000934974.1.66330 WP_000934974.1.6634 WP_000934974.1.66358 WP_000934974.1.66361 WP_000934974.1.66362 WP_000934974.1.6638 WP_000934974.1.6640 WP_000934974.1.66480 WP_000934974.1.66506 WP_000934974.1.66600 WP_000934974.1.66665 WP_000934974.1.66678 WP_000934974.1.66681 WP_000934974.1.66684 WP_000934974.1.66698 WP_000934974.1.66755 WP_000934974.1.66759 WP_000934974.1.6680 WP_000934974.1.66801 WP_000934974.1.66807 WP_000934974.1.66820 WP_000934974.1.66824 WP_000934974.1.66834 WP_000934974.1.66860 WP_000934974.1.66901 WP_000934974.1.6692 WP_000934974.1.66937 WP_000934974.1.66953 WP_000934974.1.66955 WP_000934974.1.66962 WP_000934974.1.66981 WP_000934974.1.67 WP_000934974.1.67024 WP_000934974.1.67037 WP_000934974.1.67042 WP_000934974.1.67045 WP_000934974.1.67100 WP_000934974.1.67101 WP_000934974.1.67143 WP_000934974.1.67181 WP_000934974.1.67201 WP_000934974.1.67211 WP_000934974.1.67228 WP_000934974.1.67235 WP_000934974.1.67237 WP_000934974.1.67268 WP_000934974.1.67288 WP_000934974.1.67336 WP_000934974.1.67339 WP_000934974.1.67347 WP_000934974.1.67387 WP_000934974.1.6739 WP_000934974.1.67394 WP_000934974.1.67397 WP_000934974.1.67403 WP_000934974.1.67430 WP_000934974.1.67442 WP_000934974.1.67539 WP_000934974.1.67552 WP_000934974.1.67556 WP_000934974.1.67576 WP_000934974.1.67604 WP_000934974.1.67619 WP_000934974.1.67625 WP_000934974.1.67627 WP_000934974.1.67641 WP_000934974.1.67657 WP_000934974.1.67673 WP_000934974.1.67682 WP_000934974.1.67700 WP_000934974.1.67718 WP_000934974.1.67729 WP_000934974.1.67774 WP_000934974.1.67803 WP_000934974.1.67814 WP_000934974.1.67820 WP_000934974.1.67825 WP_000934974.1.67827 WP_000934974.1.67829 WP_000934974.1.67887 WP_000934974.1.67905 WP_000934974.1.67910 WP_000934974.1.67954 WP_000934974.1.67969 WP_000934974.1.68 WP_000934974.1.68043 WP_000934974.1.68073 WP_000934974.1.6809 WP_000934974.1.68105 WP_000934974.1.68113 WP_000934974.1.68131 WP_000934974.1.68147 WP_000934974.1.68182 WP_000934974.1.6819 WP_000934974.1.68201 WP_000934974.1.68206 WP_000934974.1.6827 WP_000934974.1.68275 WP_000934974.1.68285 WP_000934974.1.68359 WP_000934974.1.68401 WP_000934974.1.68420 WP_000934974.1.68477 WP_000934974.1.68478 WP_000934974.1.6849 WP_000934974.1.685 WP_000934974.1.68514 WP_000934974.1.68532 WP_000934974.1.68547 WP_000934974.1.68564 WP_000934974.1.68589 WP_000934974.1.68591 WP_000934974.1.68655 WP_000934974.1.68656 WP_000934974.1.68688 WP_000934974.1.68690 WP_000934974.1.68742 WP_000934974.1.68770 WP_000934974.1.68778 WP_000934974.1.68787 WP_000934974.1.68809 WP_000934974.1.68894 WP_000934974.1.68914 WP_000934974.1.68928 WP_000934974.1.68958 WP_000934974.1.68975 WP_000934974.1.68999 WP_000934974.1.69001 WP_000934974.1.69006 WP_000934974.1.6904 WP_000934974.1.69053 WP_000934974.1.6907 WP_000934974.1.6913 WP_000934974.1.69146 WP_000934974.1.69151 WP_000934974.1.69170 WP_000934974.1.69210 WP_000934974.1.69255 WP_000934974.1.69270 WP_000934974.1.69282 WP_000934974.1.69346 WP_000934974.1.69359 WP_000934974.1.69376 WP_000934974.1.69396 WP_000934974.1.69397 WP_000934974.1.69433 WP_000934974.1.69466 WP_000934974.1.6954 WP_000934974.1.69554 WP_000934974.1.69564 WP_000934974.1.69611 WP_000934974.1.69636 WP_000934974.1.69642 WP_000934974.1.69644 WP_000934974.1.69656 WP_000934974.1.69657 WP_000934974.1.69690 WP_000934974.1.69704 WP_000934974.1.69754 WP_000934974.1.69758 WP_000934974.1.69808 WP_000934974.1.69839 WP_000934974.1.69848 WP_000934974.1.69890 WP_000934974.1.69923 WP_000934974.1.69948 WP_000934974.1.69953 WP_000934974.1.69975 WP_000934974.1.70003 WP_000934974.1.70010 WP_000934974.1.70049 WP_000934974.1.70058 WP_000934974.1.70061 WP_000934974.1.7016 WP_000934974.1.70169 WP_000934974.1.70205 WP_000934974.1.7021 WP_000934974.1.70240 WP_000934974.1.70241 WP_000934974.1.70248 WP_000934974.1.70249 WP_000934974.1.70261 WP_000934974.1.70269 WP_000934974.1.70289 WP_000934974.1.70303 WP_000934974.1.70314 WP_000934974.1.70321 WP_000934974.1.70327 WP_000934974.1.7033 WP_000934974.1.70427 WP_000934974.1.70433 WP_000934974.1.70447 WP_000934974.1.70485 WP_000934974.1.70545 WP_000934974.1.7060 WP_000934974.1.70623 WP_000934974.1.70643 WP_000934974.1.70644 WP_000934974.1.70662 WP_000934974.1.70671 WP_000934974.1.70679 WP_000934974.1.70683 WP_000934974.1.70708 WP_000934974.1.70717 WP_000934974.1.70731 WP_000934974.1.70733 WP_000934974.1.70761 WP_000934974.1.70772 WP_000934974.1.70845 WP_000934974.1.70846 WP_000934974.1.70883 WP_000934974.1.70899 WP_000934974.1.70914 WP_000934974.1.70922 WP_000934974.1.70929 WP_000934974.1.70948 WP_000934974.1.70969 WP_000934974.1.70971 WP_000934974.1.70977 WP_000934974.1.70981 WP_000934974.1.70995 WP_000934974.1.71010 WP_000934974.1.71023 WP_000934974.1.71039 WP_000934974.1.71057 WP_000934974.1.71081 WP_000934974.1.7110 WP_000934974.1.71116 WP_000934974.1.71117 WP_000934974.1.71146 WP_000934974.1.71165 WP_000934974.1.71186 WP_000934974.1.71188 WP_000934974.1.71202 WP_000934974.1.71243 WP_000934974.1.71248 WP_000934974.1.71299 WP_000934974.1.71306 WP_000934974.1.71337 WP_000934974.1.71363 WP_000934974.1.71368 WP_000934974.1.71378 WP_000934974.1.714 WP_000934974.1.71401 WP_000934974.1.71418 WP_000934974.1.71446 WP_000934974.1.71455 WP_000934974.1.71456 WP_000934974.1.71481 WP_000934974.1.71487 WP_000934974.1.71523 WP_000934974.1.71542 WP_000934974.1.71566 WP_000934974.1.71600 WP_000934974.1.71636 WP_000934974.1.71640 WP_000934974.1.71651 WP_000934974.1.71653 WP_000934974.1.71656 WP_000934974.1.71691 WP_000934974.1.71702 WP_000934974.1.71716 WP_000934974.1.7174 WP_000934974.1.71750 WP_000934974.1.71756 WP_000934974.1.71798 WP_000934974.1.71845 WP_000934974.1.71848 WP_000934974.1.71872 WP_000934974.1.71881 WP_000934974.1.71908 WP_000934974.1.71950 WP_000934974.1.71952 WP_000934974.1.71954 WP_000934974.1.71973 WP_000934974.1.71985 WP_000934974.1.72003 WP_000934974.1.72073 WP_000934974.1.72105 WP_000934974.1.72107 WP_000934974.1.72121 WP_000934974.1.72182 WP_000934974.1.72203 WP_000934974.1.72220 WP_000934974.1.72226 WP_000934974.1.72243 WP_000934974.1.72254 WP_000934974.1.72269 WP_000934974.1.72281 WP_000934974.1.72307 WP_000934974.1.72350 WP_000934974.1.72351 WP_000934974.1.72372 WP_000934974.1.72376 WP_000934974.1.72383 WP_000934974.1.72403 WP_000934974.1.72461 WP_000934974.1.72470 WP_000934974.1.72527 WP_000934974.1.7255 WP_000934974.1.72594 WP_000934974.1.72625 WP_000934974.1.72631 WP_000934974.1.72638 WP_000934974.1.72642 WP_000934974.1.72667 WP_000934974.1.72674 WP_000934974.1.72689 WP_000934974.1.72724 WP_000934974.1.72728 WP_000934974.1.72789 WP_000934974.1.72793 WP_000934974.1.72797 WP_000934974.1.72828 WP_000934974.1.72871 WP_000934974.1.72872 WP_000934974.1.72896 WP_000934974.1.72946 WP_000934974.1.72968 WP_000934974.1.72969 WP_000934974.1.72975 WP_000934974.1.72987 WP_000934974.1.7304 WP_000934974.1.73052 WP_000934974.1.73062 WP_000934974.1.73102 WP_000934974.1.7311 WP_000934974.1.73114 WP_000934974.1.73125 WP_000934974.1.7315 WP_000934974.1.73164 WP_000934974.1.73177 WP_000934974.1.73180 WP_000934974.1.73200 WP_000934974.1.73258 WP_000934974.1.73285 WP_000934974.1.7332 WP_000934974.1.7333 WP_000934974.1.7334 WP_000934974.1.73352 WP_000934974.1.73377 WP_000934974.1.73389 WP_000934974.1.73425 WP_000934974.1.73461 WP_000934974.1.73481 WP_000934974.1.73488 WP_000934974.1.73504 WP_000934974.1.7353 WP_000934974.1.73544 WP_000934974.1.7356 WP_000934974.1.73561 WP_000934974.1.73581 WP_000934974.1.73596 WP_000934974.1.73598 WP_000934974.1.7361 WP_000934974.1.73617 WP_000934974.1.73648 WP_000934974.1.73667 WP_000934974.1.73669 WP_000934974.1.73753 WP_000934974.1.73758 WP_000934974.1.73764 WP_000934974.1.73768 WP_000934974.1.73794 WP_000934974.1.73831 WP_000934974.1.73847 WP_000934974.1.73849 WP_000934974.1.7387 WP_000934974.1.73901 WP_000934974.1.73924 WP_000934974.1.73926 WP_000934974.1.7394 WP_000934974.1.73945 WP_000934974.1.73948 WP_000934974.1.73956 WP_000934974.1.73958 WP_000934974.1.73999 WP_000934974.1.74024 WP_000934974.1.74029 WP_000934974.1.74030 WP_000934974.1.74038 WP_000934974.1.74043 WP_000934974.1.74049 WP_000934974.1.74058 WP_000934974.1.74070 WP_000934974.1.74077 WP_000934974.1.74089 WP_000934974.1.74135 WP_000934974.1.74181 WP_000934974.1.74191 WP_000934974.1.74214 WP_000934974.1.74241 WP_000934974.1.74285 WP_000934974.1.7430 WP_000934974.1.74317 WP_000934974.1.7433 WP_000934974.1.74379 WP_000934974.1.74402 WP_000934974.1.74410 WP_000934974.1.74415 WP_000934974.1.74454 WP_000934974.1.74466 WP_000934974.1.745 WP_000934974.1.74500 WP_000934974.1.74529 WP_000934974.1.74545 WP_000934974.1.74616 WP_000934974.1.74620 WP_000934974.1.74621 WP_000934974.1.74639 WP_000934974.1.74647 WP_000934974.1.74661 WP_000934974.1.74677 WP_000934974.1.74699 WP_000934974.1.74741 WP_000934974.1.74745 WP_000934974.1.74826 WP_000934974.1.74831 WP_000934974.1.74894 WP_000934974.1.7491 WP_000934974.1.74929 WP_000934974.1.74939 WP_000934974.1.74973 WP_000934974.1.75009 WP_000934974.1.7507 WP_000934974.1.75089 WP_000934974.1.75116 WP_000934974.1.75129 WP_000934974.1.75177 WP_000934974.1.75180 WP_000934974.1.75187 WP_000934974.1.75237 WP_000934974.1.75273 WP_000934974.1.75288 WP_000934974.1.75296 WP_000934974.1.75301 WP_000934974.1.75334 WP_000934974.1.75362 WP_000934974.1.75371 WP_000934974.1.75385 WP_000934974.1.75392 WP_000934974.1.75402 WP_000934974.1.75413 WP_000934974.1.7543 WP_000934974.1.75433 WP_000934974.1.75494 WP_000934974.1.75532 WP_000934974.1.75565 WP_000934974.1.75585 WP_000934974.1.75593 WP_000934974.1.75609 WP_000934974.1.75610 WP_000934974.1.75626 WP_000934974.1.75633 WP_000934974.1.75718 WP_000934974.1.75740 WP_000934974.1.75745 WP_000934974.1.75760 WP_000934974.1.75764 WP_000934974.1.75828 WP_000934974.1.75837 WP_000934974.1.75844 WP_000934974.1.75874 WP_000934974.1.75884 WP_000934974.1.75886 WP_000934974.1.75898 WP_000934974.1.75945 WP_000934974.1.76020 WP_000934974.1.76024 WP_000934974.1.76081 WP_000934974.1.76097 WP_000934974.1.76115 WP_000934974.1.76116 WP_000934974.1.76122 WP_000934974.1.76162 WP_000934974.1.76252 WP_000934974.1.76256 WP_000934974.1.76327 WP_000934974.1.76339 WP_000934974.1.7634 WP_000934974.1.76364 WP_000934974.1.76366 WP_000934974.1.76417 WP_000934974.1.76445 WP_000934974.1.7646 WP_000934974.1.76471 WP_000934974.1.76510 WP_000934974.1.76548 WP_000934974.1.76558 WP_000934974.1.76572 WP_000934974.1.76576 WP_000934974.1.7660 WP_000934974.1.76641 WP_000934974.1.76651 WP_000934974.1.76653 WP_000934974.1.76673 WP_000934974.1.76706 WP_000934974.1.76721 WP_000934974.1.76738 WP_000934974.1.76756 WP_000934974.1.76760 WP_000934974.1.76788 WP_000934974.1.76799 WP_000934974.1.76806 WP_000934974.1.7684 WP_000934974.1.76854 WP_000934974.1.76875 WP_000934974.1.76880 WP_000934974.1.76899 WP_000934974.1.76916 WP_000934974.1.76932 WP_000934974.1.76973 WP_000934974.1.76988 WP_000934974.1.77016 WP_000934974.1.77038 WP_000934974.1.77047 WP_000934974.1.77067 WP_000934974.1.77080 WP_000934974.1.77087 WP_000934974.1.77090 WP_000934974.1.77111 WP_000934974.1.7712 WP_000934974.1.77177 WP_000934974.1.77180 WP_000934974.1.77184 WP_000934974.1.77241 WP_000934974.1.77244 WP_000934974.1.77267 WP_000934974.1.77292 WP_000934974.1.77299 WP_000934974.1.77313 WP_000934974.1.77349 WP_000934974.1.77384 WP_000934974.1.77390 WP_000934974.1.77436 WP_000934974.1.77501 WP_000934974.1.77512 WP_000934974.1.77513 WP_000934974.1.77514 WP_000934974.1.77529 WP_000934974.1.77549 WP_000934974.1.77563 WP_000934974.1.77565 WP_000934974.1.77646 WP_000934974.1.77692 WP_000934974.1.77702 WP_000934974.1.77710 WP_000934974.1.77713 WP_000934974.1.7772 WP_000934974.1.77754 WP_000934974.1.7782 WP_000934974.1.77825 WP_000934974.1.77837 WP_000934974.1.7784 WP_000934974.1.77851 WP_000934974.1.77898 WP_000934974.1.77900 WP_000934974.1.77918 WP_000934974.1.77923 WP_000934974.1.77960 WP_000934974.1.77975 WP_000934974.1.77987 WP_000934974.1.78035 WP_000934974.1.78048 WP_000934974.1.78053 WP_000934974.1.78076 WP_000934974.1.78096 WP_000934974.1.78100 WP_000934974.1.78107 WP_000934974.1.78110 WP_000934974.1.78120 WP_000934974.1.7814 WP_000934974.1.78166 WP_000934974.1.78192 WP_000934974.1.78195 WP_000934974.1.78201 WP_000934974.1.78291 WP_000934974.1.78301 WP_000934974.1.78309 WP_000934974.1.78320 WP_000934974.1.78352 WP_000934974.1.78372 WP_000934974.1.78382 WP_000934974.1.78383 WP_000934974.1.78388 WP_000934974.1.78407 WP_000934974.1.78410 WP_000934974.1.78618 WP_000934974.1.7862 WP_000934974.1.78626 WP_000934974.1.78661 WP_000934974.1.78673 WP_000934974.1.78674 WP_000934974.1.78676 WP_000934974.1.78715 WP_000934974.1.78735 WP_000934974.1.78738 WP_000934974.1.78761 WP_000934974.1.78802 WP_000934974.1.78830 WP_000934974.1.78838 WP_000934974.1.78871 WP_000934974.1.78874 WP_000934974.1.78881 WP_000934974.1.789 WP_000934974.1.78918 WP_000934974.1.78928 WP_000934974.1.78930 WP_000934974.1.78959 WP_000934974.1.78993 WP_000934974.1.79012 WP_000934974.1.79069 WP_000934974.1.79074 WP_000934974.1.79098 WP_000934974.1.79140 WP_000934974.1.79151 WP_000934974.1.79155 WP_000934974.1.79164 WP_000934974.1.79167 WP_000934974.1.79204 WP_000934974.1.79280 WP_000934974.1.79297 WP_000934974.1.79335 WP_000934974.1.79370 WP_000934974.1.79397 WP_000934974.1.79456 WP_000934974.1.79462 WP_000934974.1.79466 WP_000934974.1.79472 WP_000934974.1.79490 WP_000934974.1.79495 WP_000934974.1.79529 WP_000934974.1.79531 WP_000934974.1.79532 WP_000934974.1.79547 WP_000934974.1.79570 WP_000934974.1.7964 WP_000934974.1.79642 WP_000934974.1.79654 WP_000934974.1.79659 WP_000934974.1.79668 WP_000934974.1.7970 WP_000934974.1.79708 WP_000934974.1.79722 WP_000934974.1.79734 WP_000934974.1.79757 WP_000934974.1.79772 WP_000934974.1.7979 WP_000934974.1.79845 WP_000934974.1.79880 WP_000934974.1.79914 WP_000934974.1.79916 WP_000934974.1.79951 WP_000934974.1.79974 WP_000934974.1.79977 WP_000934974.1.80045 WP_000934974.1.80065 WP_000934974.1.80077 WP_000934974.1.80103 WP_000934974.1.80137 WP_000934974.1.80182 WP_000934974.1.80250 WP_000934974.1.80273 WP_000934974.1.80282 WP_000934974.1.80293 WP_000934974.1.80296 WP_000934974.1.80354 WP_000934974.1.80366 WP_000934974.1.80368 WP_000934974.1.80386 WP_000934974.1.80400 WP_000934974.1.80443 WP_000934974.1.80462 WP_000934974.1.80473 WP_000934974.1.80479 WP_000934974.1.8049 WP_000934974.1.80492 WP_000934974.1.80529 WP_000934974.1.80542 WP_000934974.1.80569 WP_000934974.1.80586 WP_000934974.1.80609 WP_000934974.1.80651 WP_000934974.1.80664 WP_000934974.1.80696 WP_000934974.1.80725 WP_000934974.1.80741 WP_000934974.1.80780 WP_000934974.1.80831 WP_000934974.1.80850 WP_000934974.1.80881 WP_000934974.1.80913 WP_000934974.1.80939 WP_000934974.1.80959 WP_000934974.1.8096 WP_000934974.1.80984 WP_000934974.1.81037 WP_000934974.1.81041 WP_000934974.1.81069 WP_000934974.1.81084 WP_000934974.1.81131 WP_000934974.1.81149 WP_000934974.1.81175 WP_000934974.1.81187 WP_000934974.1.8119 WP_000934974.1.81193 WP_000934974.1.81262 WP_000934974.1.81268 WP_000934974.1.81269 WP_000934974.1.81271 WP_000934974.1.81305 WP_000934974.1.8131 WP_000934974.1.81320 WP_000934974.1.81328 WP_000934974.1.81333 WP_000934974.1.81342 WP_000934974.1.81354 WP_000934974.1.81364 WP_000934974.1.81410 WP_000934974.1.81425 WP_000934974.1.81455 WP_000934974.1.81494 WP_000934974.1.81504 WP_000934974.1.81528 WP_000934974.1.81557 WP_000934974.1.81568 WP_000934974.1.81676 WP_000934974.1.81681 WP_000934974.1.8170 WP_000934974.1.81735 WP_000934974.1.81736 WP_000934974.1.81743 WP_000934974.1.81750 WP_000934974.1.81760 WP_000934974.1.81763 WP_000934974.1.81785 WP_000934974.1.81795 WP_000934974.1.81798 WP_000934974.1.81855 WP_000934974.1.81902 WP_000934974.1.81921 WP_000934974.1.81931 WP_000934974.1.81936 WP_000934974.1.81949 WP_000934974.1.81974 WP_000934974.1.81995 WP_000934974.1.82070 WP_000934974.1.82076 WP_000934974.1.82131 WP_000934974.1.82156 WP_000934974.1.8218 WP_000934974.1.82180 WP_000934974.1.82192 WP_000934974.1.82201 WP_000934974.1.82214 WP_000934974.1.82225 WP_000934974.1.82232 WP_000934974.1.82269 WP_000934974.1.82337 WP_000934974.1.82395 WP_000934974.1.8240 WP_000934974.1.82408 WP_000934974.1.82416 WP_000934974.1.8242 WP_000934974.1.82456 WP_000934974.1.82464 WP_000934974.1.82465 WP_000934974.1.82473 WP_000934974.1.82479 WP_000934974.1.82503 WP_000934974.1.82515 WP_000934974.1.82553 WP_000934974.1.82584 WP_000934974.1.82646 WP_000934974.1.82670 WP_000934974.1.82676 WP_000934974.1.82692 WP_000934974.1.82731 WP_000934974.1.82761 WP_000934974.1.82763 WP_000934974.1.82812 WP_000934974.1.8282 WP_000934974.1.82841 WP_000934974.1.82850 WP_000934974.1.82867 WP_000934974.1.82872 WP_000934974.1.82886 WP_000934974.1.82937 WP_000934974.1.8294 WP_000934974.1.82944 WP_000934974.1.82946 WP_000934974.1.82956 WP_000934974.1.82959 WP_000934974.1.83007 WP_000934974.1.8304 WP_000934974.1.83092 WP_000934974.1.83128 WP_000934974.1.83139 WP_000934974.1.83163 WP_000934974.1.83180 WP_000934974.1.8322 WP_000934974.1.83229 WP_000934974.1.83235 WP_000934974.1.83258 WP_000934974.1.83280 WP_000934974.1.83290 WP_000934974.1.83305 WP_000934974.1.83333 WP_000934974.1.83365 WP_000934974.1.83378 WP_000934974.1.83382 WP_000934974.1.83407 WP_000934974.1.83413 WP_000934974.1.83491 WP_000934974.1.83516 WP_000934974.1.83523 WP_000934974.1.8354 WP_000934974.1.83650 WP_000934974.1.83651 WP_000934974.1.83657 WP_000934974.1.83677 WP_000934974.1.83721 WP_000934974.1.8375 WP_000934974.1.83759 WP_000934974.1.83760 WP_000934974.1.83806 WP_000934974.1.83854 WP_000934974.1.83923 WP_000934974.1.83979 WP_000934974.1.83994 WP_000934974.1.83995 WP_000934974.1.84 WP_000934974.1.84001 WP_000934974.1.84031 WP_000934974.1.8406 WP_000934974.1.84076 WP_000934974.1.84100 WP_000934974.1.84103 WP_000934974.1.84110 WP_000934974.1.84127 WP_000934974.1.84150 WP_000934974.1.84168 WP_000934974.1.84179 WP_000934974.1.84209 WP_000934974.1.84230 WP_000934974.1.8425 WP_000934974.1.84252 WP_000934974.1.84283 WP_000934974.1.84291 WP_000934974.1.8431 WP_000934974.1.84345 WP_000934974.1.84355 WP_000934974.1.84359 WP_000934974.1.84369 WP_000934974.1.84392 WP_000934974.1.84397 WP_000934974.1.84401 WP_000934974.1.8441 WP_000934974.1.84435 WP_000934974.1.84461 WP_000934974.1.84532 WP_000934974.1.84554 WP_000934974.1.84567 WP_000934974.1.84631 WP_000934974.1.84659 WP_000934974.1.84693 WP_000934974.1.84727 WP_000934974.1.84744 WP_000934974.1.84773 WP_000934974.1.84814 WP_000934974.1.84872 WP_000934974.1.84879 WP_000934974.1.84899 WP_000934974.1.849 WP_000934974.1.84945 WP_000934974.1.84967 WP_000934974.1.8497 WP_000934974.1.85004 WP_000934974.1.8502 WP_000934974.1.85039 WP_000934974.1.85126 WP_000934974.1.85134 WP_000934974.1.85153 WP_000934974.1.85178 WP_000934974.1.85180 WP_000934974.1.85190 WP_000934974.1.85217 WP_000934974.1.85273 WP_000934974.1.8533 WP_000934974.1.85338 WP_000934974.1.85339 WP_000934974.1.85408 WP_000934974.1.8545 WP_000934974.1.85481 WP_000934974.1.85483 WP_000934974.1.85511 WP_000934974.1.85512 WP_000934974.1.85541 WP_000934974.1.8556 WP_000934974.1.85568 WP_000934974.1.8557 WP_000934974.1.85606 WP_000934974.1.85615 WP_000934974.1.85617 WP_000934974.1.85635 WP_000934974.1.85646 WP_000934974.1.85663 WP_000934974.1.85665 WP_000934974.1.85669 WP_000934974.1.85671 WP_000934974.1.85672 WP_000934974.1.85675 WP_000934974.1.85688 WP_000934974.1.85703 WP_000934974.1.85728 WP_000934974.1.85742 WP_000934974.1.85746 WP_000934974.1.85777 WP_000934974.1.85811 WP_000934974.1.85855 WP_000934974.1.85886 WP_000934974.1.859 WP_000934974.1.85900 WP_000934974.1.85904 WP_000934974.1.85917 WP_000934974.1.8594 WP_000934974.1.85976 WP_000934974.1.85977 WP_000934974.1.860 WP_000934974.1.86007 WP_000934974.1.86043 WP_000934974.1.8605 WP_000934974.1.86084 WP_000934974.1.8610 WP_000934974.1.8614 WP_000934974.1.86156 WP_000934974.1.86159 WP_000934974.1.86173 WP_000934974.1.86240 WP_000934974.1.86284 WP_000934974.1.86306 WP_000934974.1.86316 WP_000934974.1.86323 WP_000934974.1.86342 WP_000934974.1.86356 WP_000934974.1.86389 WP_000934974.1.8640 WP_000934974.1.8642 WP_000934974.1.86426 WP_000934974.1.86450 WP_000934974.1.86453 WP_000934974.1.86466 WP_000934974.1.86469 WP_000934974.1.86489 WP_000934974.1.86530 WP_000934974.1.86580 WP_000934974.1.86588 WP_000934974.1.86656 WP_000934974.1.86661 WP_000934974.1.86663 WP_000934974.1.8671 WP_000934974.1.86770 WP_000934974.1.8678 WP_000934974.1.86794 WP_000934974.1.86800 WP_000934974.1.86807 WP_000934974.1.86810 WP_000934974.1.86811 WP_000934974.1.86815 WP_000934974.1.8684 WP_000934974.1.86859 WP_000934974.1.86860 WP_000934974.1.86895 WP_000934974.1.86906 WP_000934974.1.8691 WP_000934974.1.86945 WP_000934974.1.86989 WP_000934974.1.87023 WP_000934974.1.87034 WP_000934974.1.87041 WP_000934974.1.87095 WP_000934974.1.87136 WP_000934974.1.87148 WP_000934974.1.87155 WP_000934974.1.87219 WP_000934974.1.87220 WP_000934974.1.87258 WP_000934974.1.87276 WP_000934974.1.87282 WP_000934974.1.87293 WP_000934974.1.87323 WP_000934974.1.8736 WP_000934974.1.87376 WP_000934974.1.87420 WP_000934974.1.87460 WP_000934974.1.87528 WP_000934974.1.87552 WP_000934974.1.87560 WP_000934974.1.8760 WP_000934974.1.87600 WP_000934974.1.87609 WP_000934974.1.87612 WP_000934974.1.87615 WP_000934974.1.87618 WP_000934974.1.87626 WP_000934974.1.87651 WP_000934974.1.87653 WP_000934974.1.87659 WP_000934974.1.87687 WP_000934974.1.87698 WP_000934974.1.87706 WP_000934974.1.87739 WP_000934974.1.87741 WP_000934974.1.87742 WP_000934974.1.87760 WP_000934974.1.87779 WP_000934974.1.87852 WP_000934974.1.87875 WP_000934974.1.87891 WP_000934974.1.87899 WP_000934974.1.8792 WP_000934974.1.87936 WP_000934974.1.87945 WP_000934974.1.87949 WP_000934974.1.88019 WP_000934974.1.88025 WP_000934974.1.88026 WP_000934974.1.8805 WP_000934974.1.8806 WP_000934974.1.88073 WP_000934974.1.8809 WP_000934974.1.88092 WP_000934974.1.881 WP_000934974.1.88145 WP_000934974.1.88174 WP_000934974.1.88199 WP_000934974.1.88214 WP_000934974.1.88222 WP_000934974.1.88244 WP_000934974.1.88293 WP_000934974.1.88299 WP_000934974.1.88303 WP_000934974.1.88313 WP_000934974.1.88359 WP_000934974.1.8837 WP_000934974.1.88393 WP_000934974.1.88407 WP_000934974.1.88414 WP_000934974.1.88423 WP_000934974.1.88444 WP_000934974.1.88446 WP_000934974.1.88458 WP_000934974.1.88501 WP_000934974.1.88538 WP_000934974.1.88547 WP_000934974.1.886 WP_000934974.1.88647 WP_000934974.1.88648 WP_000934974.1.88683 WP_000934974.1.88692 WP_000934974.1.88698 WP_000934974.1.88703 WP_000934974.1.88707 WP_000934974.1.88727 WP_000934974.1.88772 WP_000934974.1.88792 WP_000934974.1.88817 WP_000934974.1.88850 WP_000934974.1.8889 WP_000934974.1.88892 WP_000934974.1.88894 WP_000934974.1.88902 WP_000934974.1.8891 WP_000934974.1.88957 WP_000934974.1.88970 WP_000934974.1.88980 WP_000934974.1.88981 WP_000934974.1.88982 WP_000934974.1.88995 WP_000934974.1.89008 WP_000934974.1.89054 WP_000934974.1.89114 WP_000934974.1.89116 WP_000934974.1.89119 WP_000934974.1.89138 WP_000934974.1.89182 WP_000934974.1.89188 WP_000934974.1.89215 WP_000934974.1.89298 WP_000934974.1.89304 WP_000934974.1.89308 WP_000934974.1.89314 WP_000934974.1.89328 WP_000934974.1.89332 WP_000934974.1.89343 WP_000934974.1.89354 WP_000934974.1.89395 WP_000934974.1.8940 WP_000934974.1.89449 WP_000934974.1.8947 WP_000934974.1.89503 WP_000934974.1.89512 WP_000934974.1.89527 WP_000934974.1.89570 WP_000934974.1.89591 WP_000934974.1.89604 WP_000934974.1.89612 WP_000934974.1.89622 WP_000934974.1.89632 WP_000934974.1.89657 WP_000934974.1.89659 WP_000934974.1.89668 WP_000934974.1.89706 WP_000934974.1.89713 WP_000934974.1.89733 WP_000934974.1.89764 WP_000934974.1.89765 WP_000934974.1.89796 WP_000934974.1.89804 WP_000934974.1.89817 WP_000934974.1.89845 WP_000934974.1.89888 WP_000934974.1.89902 WP_000934974.1.89911 WP_000934974.1.89940 WP_000934974.1.8995 WP_000934974.1.89952 WP_000934974.1.8996 WP_000934974.1.89975 WP_000934974.1.90007 WP_000934974.1.90033 WP_000934974.1.90097 WP_000934974.1.9011 WP_000934974.1.90196 WP_000934974.1.90240 WP_000934974.1.90248 WP_000934974.1.90252 WP_000934974.1.90274 WP_000934974.1.90280 WP_000934974.1.90311 WP_000934974.1.90330 WP_000934974.1.90338 WP_000934974.1.90348 WP_000934974.1.90365 WP_000934974.1.90409 WP_000934974.1.90417 WP_000934974.1.90428 WP_000934974.1.90453 WP_000934974.1.90458 WP_000934974.1.90489 WP_000934974.1.90513 WP_000934974.1.90557 WP_000934974.1.90582 WP_000934974.1.90585 WP_000934974.1.90625 WP_000934974.1.90641 WP_000934974.1.90701 WP_000934974.1.90713 WP_000934974.1.90734 WP_000934974.1.90794 WP_000934974.1.90796 WP_000934974.1.90811 WP_000934974.1.90866 WP_000934974.1.9091 WP_000934974.1.91003 WP_000934974.1.91056 WP_000934974.1.91067 WP_000934974.1.91069 WP_000934974.1.91164 WP_000934974.1.91179 WP_000934974.1.91205 WP_000934974.1.91239 WP_000934974.1.91278 WP_000934974.1.91282 WP_000934974.1.91291 WP_000934974.1.9131 WP_000934974.1.91312 WP_000934974.1.91313 WP_000934974.1.91331 WP_000934974.1.9135 WP_000934974.1.91459 WP_000934974.1.91470 WP_000934974.1.91506 WP_000934974.1.91512 WP_000934974.1.91524 WP_000934974.1.91528 WP_000934974.1.91557 WP_000934974.1.91564 WP_000934974.1.91597 WP_000934974.1.91621 WP_000934974.1.91625 WP_000934974.1.91628 WP_000934974.1.91655 WP_000934974.1.9166 WP_000934974.1.91715 WP_000934974.1.91724 WP_000934974.1.91732 WP_000934974.1.91788 WP_000934974.1.91806 WP_000934974.1.91864 WP_000934974.1.9187 WP_000934974.1.91870 WP_000934974.1.91880 WP_000934974.1.91903 WP_000934974.1.91984 WP_000934974.1.92013 WP_000934974.1.92018 WP_000934974.1.92060 WP_000934974.1.92087 WP_000934974.1.92093 WP_000934974.1.92098 WP_000934974.1.92099 WP_000934974.1.92108 WP_000934974.1.92156 WP_000934974.1.92165 WP_000934974.1.92171 WP_000934974.1.92172 WP_000934974.1.92183 WP_000934974.1.92208 WP_000934974.1.92213 WP_000934974.1.92240 WP_000934974.1.92243 WP_000934974.1.92268 WP_000934974.1.92310 WP_000934974.1.92318 WP_000934974.1.92327 WP_000934974.1.92394 WP_000934974.1.92411 WP_000934974.1.92443 WP_000934974.1.92470 WP_000934974.1.92477 WP_000934974.1.92482 WP_000934974.1.92529 WP_000934974.1.92531 WP_000934974.1.92545 WP_000934974.1.92570 WP_000934974.1.92575 WP_000934974.1.92588 WP_000934974.1.926 WP_000934974.1.92633 WP_000934974.1.92646 WP_000934974.1.92649 WP_000934974.1.92669 WP_000934974.1.92671 WP_000934974.1.92676 WP_000934974.1.92705 WP_000934974.1.9271 WP_000934974.1.92729 WP_000934974.1.92734 WP_000934974.1.92738 WP_000934974.1.92754 WP_000934974.1.92786 WP_000934974.1.92810 WP_000934974.1.92823 WP_000934974.1.92827 WP_000934974.1.92842 WP_000934974.1.92879 WP_000934974.1.92893 WP_000934974.1.92926 WP_000934974.1.92936 WP_000934974.1.92975 WP_000934974.1.92987 WP_000934974.1.93007 WP_000934974.1.93022 WP_000934974.1.93059 WP_000934974.1.93061 WP_000934974.1.93086 WP_000934974.1.93101 WP_000934974.1.93103 WP_000934974.1.93105 WP_000934974.1.93111 WP_000934974.1.93118 WP_000934974.1.93121 WP_000934974.1.93136 WP_000934974.1.93155 WP_000934974.1.93168 WP_000934974.1.93184 WP_000934974.1.93213 WP_000934974.1.93221 WP_000934974.1.93223 WP_000934974.1.93239 WP_000934974.1.93275 WP_000934974.1.93302 WP_000934974.1.93322 WP_000934974.1.9336 WP_000934974.1.93365 WP_000934974.1.93376 WP_000934974.1.93387 WP_000934974.1.93410 WP_000934974.1.93469 WP_000934974.1.93511 WP_000934974.1.93512 WP_000934974.1.93543 WP_000934974.1.93635 WP_000934974.1.93650 WP_000934974.1.93656 WP_000934974.1.93657 WP_000934974.1.93662 WP_000934974.1.93691 WP_000934974.1.937 WP_000934974.1.93705 WP_000934974.1.9374 WP_000934974.1.9375 WP_000934974.1.93754 WP_000934974.1.93761 WP_000934974.1.93780 WP_000934974.1.93804 WP_000934974.1.93828 WP_000934974.1.93842 WP_000934974.1.93843 WP_000934974.1.93875 WP_000934974.1.9389 WP_000934974.1.93909 WP_000934974.1.93919 WP_000934974.1.93937 WP_000934974.1.93938 WP_000934974.1.93984 WP_000934974.1.9399 WP_000934974.1.93994 WP_000934974.1.94017 WP_000934974.1.94039 WP_000934974.1.94071 WP_000934974.1.94072 WP_000934974.1.94079 WP_000934974.1.94097 WP_000934974.1.94107 WP_000934974.1.94132 WP_000934974.1.94142 WP_000934974.1.94162 WP_000934974.1.94168 WP_000934974.1.94198 WP_000934974.1.94215 WP_000934974.1.94303 WP_000934974.1.9432 WP_000934974.1.94352 WP_000934974.1.94354 WP_000934974.1.94365 WP_000934974.1.94380 WP_000934974.1.94390 WP_000934974.1.94412 WP_000934974.1.94415 WP_000934974.1.94458 WP_000934974.1.94492 WP_000934974.1.94510 WP_000934974.1.94527 WP_000934974.1.94565 WP_000934974.1.94573 WP_000934974.1.94579 WP_000934974.1.94584 WP_000934974.1.94586 WP_000934974.1.94593 WP_000934974.1.94650 WP_000934974.1.94655 WP_000934974.1.94659 WP_000934974.1.94662 WP_000934974.1.94674 WP_000934974.1.94700 WP_000934974.1.94717 WP_000934974.1.94745 WP_000934974.1.94782 WP_000934974.1.94796 WP_000934974.1.94798 WP_000934974.1.94815 WP_000934974.1.94817 WP_000934974.1.94820 WP_000934974.1.94850 WP_000934974.1.94851 WP_000934974.1.94864 WP_000934974.1.94959 WP_000934974.1.94967 WP_000934974.1.94982 WP_000934974.1.94983 WP_000934974.1.95006 WP_000934974.1.95051 WP_000934974.1.95055 WP_000934974.1.95076 WP_000934974.1.95085 WP_000934974.1.95099 WP_000934974.1.95121 WP_000934974.1.95133 WP_000934974.1.95152 WP_000934974.1.95165 WP_000934974.1.95239 WP_000934974.1.95246 WP_000934974.1.95248 WP_000934974.1.9525 WP_000934974.1.95255 WP_000934974.1.95265 WP_000934974.1.95277 WP_000934974.1.95282 WP_000934974.1.95298 WP_000934974.1.95338 WP_000934974.1.95388 WP_000934974.1.95404 WP_000934974.1.95412 WP_000934974.1.95530 WP_000934974.1.95546 WP_000934974.1.95547 WP_000934974.1.95558 WP_000934974.1.95579 WP_000934974.1.95590 WP_000934974.1.95623 WP_000934974.1.95625 WP_000934974.1.95630 WP_000934974.1.95641 WP_000934974.1.95670 WP_000934974.1.95675 WP_000934974.1.95691 WP_000934974.1.95701 WP_000934974.1.95716 WP_000934974.1.95729 WP_000934974.1.95744 WP_000934974.1.95776 WP_000934974.1.95826 WP_000934974.1.95840 WP_000934974.1.95884 WP_000934974.1.95890 WP_000934974.1.95906 WP_000934974.1.95911 WP_000934974.1.95939 WP_000934974.1.95940 WP_000934974.1.96004 WP_000934974.1.96025 WP_000934974.1.96042 WP_000934974.1.96044 WP_000934974.1.96054 WP_000934974.1.9609 WP_000934974.1.96094 WP_000934974.1.96127 WP_000934974.1.96139 WP_000934974.1.96144 WP_000934974.1.96162 WP_000934974.1.96188 WP_000934974.1.96203 WP_000934974.1.96211 WP_000934974.1.96212 WP_000934974.1.96317 WP_000934974.1.96319 WP_000934974.1.9633 WP_000934974.1.96335 WP_000934974.1.96343 WP_000934974.1.96359 WP_000934974.1.96429 WP_000934974.1.9644 WP_000934974.1.96469 WP_000934974.1.96490 WP_000934974.1.96497 WP_000934974.1.96500 WP_000934974.1.96539 WP_000934974.1.96552 WP_000934974.1.96555 WP_000934974.1.96563 WP_000934974.1.96584 WP_000934974.1.96610 WP_000934974.1.96625 WP_000934974.1.96635 WP_000934974.1.9664 WP_000934974.1.96642 WP_000934974.1.96675 WP_000934974.1.9670 WP_000934974.1.96731 WP_000934974.1.96732 WP_000934974.1.9674 WP_000934974.1.96750 WP_000934974.1.96771 WP_000934974.1.96792 WP_000934974.1.96801 WP_000934974.1.96803 WP_000934974.1.96890 WP_000934974.1.96902 WP_000934974.1.96925 WP_000934974.1.96938 WP_000934974.1.96946 WP_000934974.1.96957 WP_000934974.1.96978 WP_000934974.1.97015 WP_000934974.1.97026 WP_000934974.1.97028 WP_000934974.1.97047 WP_000934974.1.97079 WP_000934974.1.97089 WP_000934974.1.97143 WP_000934974.1.97145 WP_000934974.1.97154 WP_000934974.1.97184 WP_000934974.1.97185 WP_000934974.1.97190 WP_000934974.1.97287 WP_000934974.1.97291 WP_000934974.1.97297 WP_000934974.1.97318 WP_000934974.1.97337 WP_000934974.1.97369 WP_000934974.1.97386 WP_000934974.1.97413 WP_000934974.1.97422 WP_000934974.1.97441 WP_000934974.1.97477 WP_000934974.1.97480 WP_000934974.1.97487 WP_000934974.1.97497 WP_000934974.1.97505 WP_000934974.1.97594 WP_000934974.1.97597 WP_000934974.1.97599 WP_000934974.1.97606 WP_000934974.1.97613 WP_000934974.1.97615 WP_000934974.1.97620 WP_000934974.1.97631 WP_000934974.1.97646 WP_000934974.1.97690 WP_000934974.1.97691 WP_000934974.1.97727 WP_000934974.1.97732 WP_000934974.1.97736 WP_000934974.1.9775 WP_000934974.1.97772 WP_000934974.1.97800 WP_000934974.1.97819 WP_000934974.1.97840 WP_000934974.1.97846 WP_000934974.1.97907 WP_000934974.1.97938 WP_000934974.1.97986 WP_000934974.1.9799 WP_000934974.1.98006 WP_000934974.1.98019 WP_000934974.1.98022 WP_000934974.1.98036 WP_000934974.1.98080 WP_000934974.1.98086 WP_000934974.1.98107 WP_000934974.1.98110 WP_000934974.1.98146 WP_000934974.1.98158 WP_000934974.1.98170 WP_000934974.1.98219 WP_000934974.1.98236 WP_000934974.1.98250 WP_000934974.1.9826 WP_000934974.1.98263 WP_000934974.1.98402 WP_000934974.1.9841 WP_000934974.1.98418 WP_000934974.1.98438 WP_000934974.1.98446 WP_000934974.1.98448 WP_000934974.1.98457 WP_000934974.1.98495 WP_000934974.1.9850 WP_000934974.1.98502 WP_000934974.1.98531 WP_000934974.1.98577 WP_000934974.1.98607 WP_000934974.1.98608 WP_000934974.1.98627 WP_000934974.1.9863 WP_000934974.1.98676 WP_000934974.1.98677 WP_000934974.1.98731 WP_000934974.1.98760 WP_000934974.1.98762 WP_000934974.1.98763 WP_000934974.1.9877 WP_000934974.1.98801 WP_000934974.1.98818 WP_000934974.1.98843 WP_000934974.1.98899 WP_000934974.1.9898 WP_000934974.1.99071 WP_000934974.1.99072 WP_000934974.1.99073 WP_000934974.1.99098 WP_000934974.1.99163 WP_000934974.1.99184 WP_000934974.1.9919 WP_000934974.1.99197 WP_000934974.1.99267 WP_000934974.1.99276 WP_000934974.1.99278 WP_000934974.1.99335 WP_000934974.1.99339 WP_000934974.1.99350 WP_000934974.1.99360 WP_000934974.1.99363 WP_000934974.1.99369 WP_000934974.1.99388 WP_000934974.1.99397 WP_000934974.1.99426 WP_000934974.1.99463 WP_000934974.1.99483 WP_000934974.1.99531 WP_000934974.1.9954 WP_000934974.1.99546 WP_000934974.1.99577 WP_000934974.1.99579 WP_000934974.1.99595 WP_000934974.1.99626 WP_000934974.1.99646 WP_000934974.1.99657 WP_000934974.1.99660 WP_000934974.1.99671 WP_000934974.1.99676 WP_000934974.1.99712 WP_000934974.1.99725 WP_000934974.1.99764 WP_000934974.1.99783 WP_000934974.1.99813 WP_000934974.1.99824 WP_000934974.1.99829 WP_000934974.1.99837 WP_000934974.1.99841 WP_000934974.1.99858 WP_000934974.1.99889 WP_000934974.1.9992 WP_000934974.1.99958 WP_000934974.1.99996 gi|525839669|ref|YP_008257009.1| gi|198245725|ref|YP_002218289.1| gi|16767653|ref|NP_463268.1| gi|386589725|ref|YP_006086125.1| gi|383498974|ref|YP_005399663.1| gi|526218818|ref|YP_008264076.1| gi|378702245|ref|YP_005184203.1| gi|409248100|ref|YP_006888792.1| gi|197250123|ref|YP_002149321.1| gi|525815691|ref|YP_008245709.1| gi|379703645|ref|YP_005245373.1| gi|549481524|ref|YP_008615999.1| 209261.t4461 220341.STY4766 272994.SPAB_05547 295319.SPA4227 321314.SC4282 439851.SeD_A4805 454166.SeAg_B4686 454169.SeHA_C4826 476213.SPC_4557 554290.SSPA3926 99287.STM4407 gi|482906941|ref|YP_007905501.1| gi|16763227|ref|NP_458844.1| gi|62182852|ref|YP_219269.1| gi|378447718|ref|YP_005235350.1| gi|525948659|ref|YP_008310345.1| ABAM02000001|CDS_290512-289169 ABAO01000006|CDS_13489-12146 ABEL01000011|CDS_142969-144312 ABFF01000010|CDS_174523-175866 AE006468|CDS_4645019-4643676 AE014613|CDS_4607007-4605664 AE017220|CDS_4582538-4581195 AL513382|CDS_4624104-4622761 CP000026|CDS_4397591-4396248 CP000857|CDS_4659863-4658520 CP000886|CDS_4661623-4660280 CP001120|CDS_4698959-4697616 CP001138|CDS_4577351-4576008 CP001144|CDS_4660396-4659053 CP001363|CDS_4657849-4656506 FM200053|CDS_4392819-4391476 FN424405|CDS_4667006-4665663 gi|224586249|ref|YP_002640048.1| gi|197365123|ref|YP_002144760.1| gi|56416200|ref|YP_153275.1| gi|161617684|ref|YP_001591649.1| gi|563655694|ref|YP_008863798.1| gi|538364986|ref|YP_008508271.1| gi|525828063|ref|YP_008250831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]