SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920251|ref|NP_375920.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920251|ref|NP_375920.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Homeodomain-like 8.21e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|15920251|ref|NP_375920.1|
Domain Number - Region: 91-164
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000125
Family Tetracyclin repressor-like, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920251|ref|NP_375920.1|
Sequence length 194
Comment hypothetical protein ST0072 [Sulfolobus tokodaii str. 7]
Sequence
MRIPKTRKGIETVEKILNASIEVIEEKGFMNTSISDITKRANVAYGVFYYYFNNKYELFD
ELVRKANREMRYYLKIKTENIQSRIEKEKVGIREFLKWIRENKDYYKLFIEAHVHRPNML
IWHYTKLAERYSIGLSEAMRRGEIINVDPEVLSYVLIGISEILGKRYVVWNNDEIPNHVI
TEADKIIENLLKPK
Download sequence
Identical sequences Q976W7
gi|15920251|ref|NP_375920.1| 273063.ST0072 WP_010978011.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]