SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920277|ref|NP_375946.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920277|ref|NP_375946.1|
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 0.0000000000000144
Family Aminoacid dehydrogenases 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920277|ref|NP_375946.1|
Sequence length 168
Comment hypothetical protein ST0098 [Sulfolobus tokodaii str. 7]
Sequence
MQYSGILGPYAGGVIFSEEMDLDTLIDLTTISFIRNILFNLPLGSYIGCICAPRSQDKKI
LTLQYINYVRNNIDEDILIPDEGTEDMSELFYEIANIDEKYITNIIYTDYLSYSIGIAIL
LKFTLKGNFNVKIGILGSKPASTTLFSLLESLGSGDCSHAVMKFESYL
Download sequence
Identical sequences Q976U1
273063.ST0098 gi|15920277|ref|NP_375946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]