SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920349|ref|NP_376018.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920349|ref|NP_376018.1|
Domain Number 1 Region: 44-92
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000568
Family Recombinase DNA-binding domain 0.072
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000201
Family Sigma4 domain 0.026
Further Details:      
 
Weak hits

Sequence:  gi|15920349|ref|NP_376018.1|
Domain Number - Region: 100-136
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000241
Family Recombinase DNA-binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920349|ref|NP_376018.1|
Sequence length 147
Comment hypothetical protein ST0170 [Sulfolobus tokodaii str. 7]
Sequence
MMEREVIEKIKNLYNSGYTIREIAKEMNMSYGKVRNILVKEGVKMRNKVPKELIERVVEL
AKQGYSARRISKELNMNETTVLRILKEHNLGKRIKKMSQEEINQIISMYKEGKSIYEIAK
KLNRSTNLIVYYLKKYGIIRESSSTSL
Download sequence
Identical sequences Q976M0
WP_010978109.1.60790 gi|15920349|ref|NP_376018.1| 273063.ST0170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]