SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920430|ref|NP_376099.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15920430|ref|NP_376099.1|
Domain Number - Region: 52-139
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.036
Family Haloperoxidase (bromoperoxidase) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920430|ref|NP_376099.1|
Sequence length 195
Comment hypothetical protein ST0247 [Sulfolobus tokodaii str. 7]
Sequence
MGFPFFGQQPSFGSTLCGGSIGLGGKTITVPVSYPINMQYVGEQVVSYLNGMGFQVNPMI
SQNMVVIQAKHSSLFGFLTDANKAYTIRICQGPGIVTIETGVANWIQDLIPLAMSGGFSF
FSDEMLHNKLLTILGIGGTAFDAYHVYQQYAGEDQLLNYIAQIVANSPPAQGGMYGGGPY
GNPGGGFGGGYQPPY
Download sequence
Identical sequences Q976D9
WP_010978191.1.60790 273063.ST0247 gi|15920430|ref|NP_376099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]