SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920519|ref|NP_376188.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920519|ref|NP_376188.1|
Domain Number 1 Region: 31-160,419-538
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.21e-86
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0000299
Further Details:      
 
Domain Number 2 Region: 226-392
Classification Level Classification E-value
Superfamily GroEL apical domain-like 5.08e-61
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000309
Further Details:      
 
Domain Number 3 Region: 162-230,382-418
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 6.41e-28
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920519|ref|NP_376188.1|
Sequence length 559
Comment thermosome, beta subunit [Sulfolobus tokodaii str. 7]
Sequence
MLSAVEKMSTTATVATTPEGIPVIILKEGSSRTYGKEALRINIAAVKAVEEALKSTYGPR
GMDKMLVDSLGDITITNDGATILDKMDLQHPAAKLLVQIAKGQDEETADGTKTAVILAGE
LVKKAEELLYKEIHPTIIVSGFKKAEEQALKTIEEIAQKVSVNDMDILKKVAMTSLNSKA
VAGAREYLADIVAKAVTQVAELRGDRWYVDLDNIQIVKKHGGSINDTQIIYGIVVDKEVV
HPGMPKRVENAKIALLDASLEVEKPELDAEIRINDPTQMKKFLEEEENLLKEKVDKIAAT
GANVVICQKGIDEVAQHYLAKKGILAVRRAKKSDLEKLARATGGRVVSNIDELTPQDLGY
AALVEERKVGEDKMVFVEGAKNPKAVSILIRGGLERVVDETERALRDALGTVADVIRDGR
AVAGGGAVELEIAKRLRKYAPQIGGKEQLAIEAYASALENLVMILIENGGYDPIDLLVKL
RSAHENEANKWYGINVFTGQVEDMWKLGVIEPAVVKMNAIKAATEAATLILRIDDLIAAG
KKSESKGGESKSEEKKEED
Download sequence
Identical sequences 273063.ST0321 gi|15920519|ref|NP_376188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]