SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920700|ref|NP_376369.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920700|ref|NP_376369.1|
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.03e-98
Family Purine and uridine phosphorylases 0.000000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15920700|ref|NP_376369.1|
Sequence length 271
Comment 5'-methylthioadenosine phosphorylase II [Sulfolobus tokodaii str. 7]
Sequence
MMIEPKEKASIGIIGGSGLYDPQILTNVKEIKVYTPYGEPSDNIILGELEGRKVAFLPRH
GRGHRIPPHKINYRANIWALKSLGVKWVIAVSAVGSLRLDYKPGDFVVPNQFIDMTKGRT
YTFFDGPTVAHVSMADPFCEHLRSIILDSAKDLGITTHDKGTYICIEGPRFSTRAESIVW
KEVFKADIIGMTLVPEVNLACEAEMCYSVIGMVTDYDVFADIPVTAEEVTKVMAENTAKV
KKLLYEVIRRLPEKPDERKCSCCQALKTALV
Download sequence
Identical sequences gi|15920700|ref|NP_376369.1| 273063.ST0485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]