SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920717|ref|NP_376386.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920717|ref|NP_376386.1|
Domain Number 1 Region: 290-428
Classification Level Classification E-value
Superfamily vWA-like 3.5e-17
Family Integrin A (or I) domain 0.078
Further Details:      
 
Weak hits

Sequence:  gi|15920717|ref|NP_376386.1|
Domain Number - Region: 98-176
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.0288
Family Typo IV secretion system protein TraC 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920717|ref|NP_376386.1|
Sequence length 453
Comment hypothetical protein ST0501 [Sulfolobus tokodaii str. 7]
Sequence
MSEEEGFLRGIDYEDPLVRYRGERISYTLKKLSGRDLQLDENFLIDTYYIHYLPMPIPKT
KEDVPKGKEIMYRFIDMMLNSPLVEENRNYSMVNSAVSMALSVSYVQNLIEELERIKRTS
QSQEERQMAEQILNGLMKGSGGKQGQKQQQQQDSQQMEKLMKQVNDKALSKAIEDAESVR
NLQKIIGGNGAGTGSILNFEGEIHEVLRLARNTEIKKILEFLSGMPRLGSFTKKRTTRFS
RGELYGYEEGSDLERIVSSELALPEELFYIKLAESQLLLYQKRIKEVLGPIYLLLDKSGS
MDGEKIIWAKAVALALYSRARRENRDFYIRFFDNIPYPLIKVPKNAKSKDVVKMIEYIGK
IRGGGGTDISRSVISACEDIKEGHVKGVSEIILLTDGEDKIAETTVRRSLKEANSTLISV
MIRGDNADLRRVSDQYLVVYKLDHEDLLKVVEA
Download sequence
Identical sequences Q975B2
WP_010978478.1.60790 gi|15920717|ref|NP_376386.1| 273063.ST0501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]