SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920741|ref|NP_376410.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920741|ref|NP_376410.1|
Domain Number 1 Region: 5-171
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.15e-67
Family Inorganic pyrophosphatase 0.0000000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920741|ref|NP_376410.1|
Sequence length 174
Comment inorganic pyrophosphatase [Sulfolobus tokodaii str. 7]
Sequence
MKMKLSPGKKAPDEVNVLIEIPLGSNIKYEYDEEEEVVKVDRILYTSMVYPFNYGFIPGT
LEEDGDPLDVLVISNYPLLPGTAIEVRPIGILYMRDEEGEDAKIIAVPKDKVDPTFSNIK
DIIDLPQAIKDKINHFFEHYKELEPGKWVKISGWGGVSEAKTRINEAIKRANSK
Download sequence
Identical sequences gi|15920741|ref|NP_376410.1| 273063.ST0524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]