SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920766|ref|NP_376435.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920766|ref|NP_376435.1|
Domain Number 1 Region: 3-251
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 1.31e-42
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920766|ref|NP_376435.1|
Sequence length 264
Comment extragenic suppressor protein suhB [Sulfolobus tokodaii str. 7]
Sequence
MREVLVKITKEIISFLYEEKDKQGIDKIIGKHGNDVTRVIDKKSEELIFDRLNHSGYKFM
FVSEEAGVVNKENYEYIAIIDPLDGSTNYLNGIPWSSVSIAVYRRGEKDILSSFTGVVGN
IFTKKIYSYDENFSYIDEEKISTPHPPDRLLILAYFSRSRLLSVKNFLDSLNADYKIRSL
GSASLDMILVCTGKASIYFDVRGKLRNVDVAASSNFCKRLGIIPRNSRLEEIRVGIEKVE
QIQEIILSSDQNLLNLIALSLQKA
Download sequence
Identical sequences Q974W3
WP_010978527.1.60790 273063.ST0547 gi|15920766|ref|NP_376435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]