SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920843|ref|NP_376512.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920843|ref|NP_376512.1|
Domain Number 1 Region: 184-428
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.89e-87
Family Leukotriene A4 hydrolase catalytic domain 0.00073
Further Details:      
 
Domain Number 2 Region: 4-173
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.75e-40
Family Leukotriene A4 hydrolase N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920843|ref|NP_376512.1|
Sequence length 781
Comment aminopeptidase [Sulfolobus tokodaii str. 7]
Sequence
MVSIDKYEIFLDFDFKNLIYKGYEKIYLSTDNEVVLDSVGLNIVSVKTEGKSVPFKISDS
QIFIQTGKFDGVLEIEFEGKVKERGLVGIYKAPYDHSYIITTQFESVHAREFIPCIDHPA
FKARFKLSVKVDKDLDVISNMPIEDVREEGDKKIVTFQETPRMSTYLLYLGIGKFEEIKD
KLGEVDIIVATVPGRISKGKFALDVAKKVIEYYEDYFGIKYQLPKEHLIAIPEFAFGAME
NWGAITFRETALLADESSSVQQKMRVASVVAHELAHQWFGDLVTMKWWDDLWLNESFATF
MSHKAIAELYKEWDFWGTFINSETSGALFRDSLTTTHPIEAHVTSPEEIEQLFDDISYGK
GASILRMIEAYLGDEDFRKGIQIYLNTYKYSNATGSDFWNSLEKGSGKPVSEIVKDWITK
DGYPVVYVSVNGSKINLEQERFYLKGNGKNAVYKVPLTLEVNGRKITYLLEKEKDSIDIG
SDIKSIKVNIDRTGFYRVYYNDLSLVFNSKLSHLDKWGLFNDYFNFFLAGRVNYTTYESI
AKQFMKDDNYLVVDELVSELYYLWRVNRDKYKLLYEVLPYQVKRFSKRKDELSRRTYSYL
LSTFAFVDEKFASGLAVAFEKYDTLDPNVKEAVAIAYAVTYGEDAYDELLNKYRSEKFDE
EKTRLLYGLLSFREPYLVVNTMSLALTGEIKRQDVARILPYASYNPYSRLALWKWLKTHM
EFLRSIYAGTAILGRTLRSVIPFLGLNNAEVVEYFTTNRFPEMEVEIKSGLEILDSLRRI
I
Download sequence
Identical sequences Q974N6
273063.ST0623 WP_010978604.1.60790 gi|15920843|ref|NP_376512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]