SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920862|ref|NP_376531.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15920862|ref|NP_376531.1|
Domain Number - Region: 11-58
Classification Level Classification E-value
Superfamily AF1782-like 0.00122
Family AF1782-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15920862|ref|NP_376531.1|
Sequence length 156
Comment hypothetical protein ST0641 [Sulfolobus tokodaii str. 7]
Sequence
MEELIKRAKEKGIDVEDVLIREISKEDPQEGIKLRLEIAEKYMNEAYEYLNKGDSIQASE
KAYKVAEEVVKALAEKFNTEEYKQAITEGRWYTYLLVSTTNDLSKRLGDWVSDGWNAGYV
LHVWGFHEGKLSVNKITVNMEKVKKMLENAKSILMS
Download sequence
Identical sequences Q974L8
gi|15920862|ref|NP_376531.1| 273063.ST0641 WP_010978623.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]