SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920870|ref|NP_376539.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15920870|ref|NP_376539.1|
Domain Number 1 Region: 20-199
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.35e-61
Family FAD-linked oxidases, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 204-430
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 9.48e-44
Family Vanillyl-alcohol oxidase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920870|ref|NP_376539.1|
Sequence length 440
Comment glycolate oxidase subunit GlcD [Sulfolobus tokodaii str. 7]
Sequence
MLEGIEYSQGEEREDFVGFKIKPKIVVYPKNEEEIVKIVNYARETRTPIVTWGAGTSLSG
HLMCDGCILLDMSKYMNKIIEINEIDWYAHVQPGVNLEYLNKELNKKGFFFPPDPASFFL
CTVGGATANSSGGMRGVKYGTFRDWVLALKVVLPNGKVIKLGEPLRKNRGGYDLVHLFVG
SEGTLGIITEIWLRITPLPRKKIYTVLAYMKSLEDTAETIIELRKRRILPEISEYIDIDV
IRALNKNLNAGLKESEGGAFIISVEEDYLDELKDILKEREYIIAEGEEAEKIYSIRAQSA
IALRAESKYMFVEDIVVPVSKLIDAIKRLKEIERKYNVRMPVIAHIGDGNLHPNIMLSDT
SLAEQIFEEVAKIAIELGGSISGEHGIGYQKAKLLAEQIVSHNGEEVLKIMKGIKDLIDP
YDIMNPNKYVELAYKLWEKK
Download sequence
Identical sequences Q974L0
gi|15920870|ref|NP_376539.1| WP_010978631.1.60790 273063.ST0649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]