SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15920878|ref|NP_376547.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15920878|ref|NP_376547.1|
Domain Number - Region: 78-138
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0745
Family V-type ATPase subunit E 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15920878|ref|NP_376547.1|
Sequence length 233
Comment hypothetical protein ST0657 [Sulfolobus tokodaii str. 7]
Sequence
MSIKTKIRKAIKDFFQYEKEGDKKILKRALSHIRYENGYLIIRDEKIKMDREEDVIGVFL
ANIPYIVLGKGELHWDLPDKVIKIQNSALKLLECGINDVATLEIYLVMEMALRSLYSEYV
KSGVIIQYKDKKIKVNNIDYRRLKLYIRRKGWSKYKVKVNGEVFPYSQGSLLSWAEKFMD
DKLSFVFRLSVNVRNLLAHGEVEWNLFPTVRSLESASHASWLVFQKLKTYMKS
Download sequence
Identical sequences Q974K2
WP_010978639.1.60790 gi|15920878|ref|NP_376547.1| 273063.ST0657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]