SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921046|ref|NP_376715.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921046|ref|NP_376715.1|
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily YjgF-like 1.88e-46
Family YjgF/L-PSP 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921046|ref|NP_376715.1|
Sequence length 125
Comment translational inhibitor protein [Sulfolobus tokodaii str. 7]
Sequence
METVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEI
VKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAV
ICSKG
Download sequence
Identical sequences Q973T6
WP_010978807.1.60790 273063.ST0811 d1x25b2 gi|15921046|ref|NP_376715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]