SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921048|ref|NP_376717.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921048|ref|NP_376717.1|
Domain Number 1 Region: 77-198
Classification Level Classification E-value
Superfamily CBS-domain pair 6.84e-31
Family CBS-domain pair 0.00089
Further Details:      
 
Domain Number 2 Region: 200-269
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000707
Family CBS-domain pair 0.00047
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000115
Family CBS-domain pair 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921048|ref|NP_376717.1|
Sequence length 274
Comment hypothetical protein ST0813 [Sulfolobus tokodaii str. 7]
Sequence
MMLVKTLMITNPPTISVSSKLLEAFKKVNEKGIGRVIVEDNEIKGIISTRDLLNYVVERC
EKGCDRGDIFALVDKDVKYVMTPNPVYVYENDDVLDALTLMVARNFGSLPVVNEVKKVTG
IVTEREMLLIFQDLDQLFSVKKFMTKRVTSVYEDVSVFDATKLMIKRGFRRLPVINESGE
VIGIITAADSLKLLTKTILKNEPEMFFNKKVKEVATNEIYSIDPEKSINEAAATMLMKKI
GSLLILDSKNRPLGIITERDLIIALHYQLHLKTS
Download sequence
Identical sequences 273063.ST0813 gi|15921048|ref|NP_376717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]