SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921055|ref|NP_376724.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921055|ref|NP_376724.1|
Domain Number 1 Region: 10-139,400-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.3e-83
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 207-373
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.4e-50
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000632
Further Details:      
 
Domain Number 3 Region: 139-211,364-397
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.65e-23
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921055|ref|NP_376724.1|
Sequence length 545
Comment hypothetical protein ST0820 [Sulfolobus tokodaii str. 7]
Sequence
MYSLFRQGTQKESGEDVLRSNILAVRTLSEMLKSSLGPRGLDKMLISSTNDVTVTNDGVT
IVKEMDVQHPAAKLVVEAAKAQDTQVGDGTTSAVVLTGFLLEQAEKLLDQKVHPTIIIEG
YKRASDIILSHSKEVAIKINTSDKDYLRKVTYTSLSSKFFSGESTLNKIIDISIDAVVSI
AKKQDSSYNIDLSDIKFVKKRGESVDETELIRGFVLDKEVAHENMPRRIEKAKIAIIDFP
LEVEKPEISAKMSFTSPDQIREALEEQSKYVKSLVDALANVGANVIVSQKGMDDIASYFM
AKKKIIGVKNVSRSDLEKLAKSVGAKIITTIKDVSPDDLGYAEVVEERKIGNSKAVFFEG
AKQGDAVTILIRGSSDIVMDELERSFQDSLNTVKNVLQYPYVVAGGGAFEMEMALKLREE
ARKIGGKEQLAVEAYADALEEFAITLAETAGLDSVDALVQLRNLHSKGLRNAGINVESGK
VEEDMAKIGVLDPLIVKEQVIKSSTEAATAILKIDDYIAAAPAKPQPQQGQGGEGGGGMM
PGMMG
Download sequence
Identical sequences F9VN97
WP_010978816.1.60790 273063.ST0820 gi|15921055|ref|NP_376724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]