SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921105|ref|NP_376774.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921105|ref|NP_376774.1|
Domain Number 1 Region: 7-192
Classification Level Classification E-value
Superfamily Flavoproteins 1.33e-70
Family SCOPe 0.000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921105|ref|NP_376774.1|
Sequence length 199
Comment trp repressor-binding protein [Sulfolobus tokodaii str. 7]
Sequence
MSCKPNILVLFYGYGSIVELAKEIGKGAEEAGAEVKIRRVRETLPPEFQSRIPFDKVKDI
PEVTLDDMRWADGFAIGSPTRYGNMAGGLKTFLDTTAILWKDNVLYGKPVTFFTEASTVH
GGHETTILTMSTYAYHFGMIIVPIGYGIPELFQTTTGGGPYGATHLGSKEELDEMERKIA
RFQGKRITEVAKAIKCCNK
Download sequence
Identical sequences F9VNA8
cath|current|2zkiA00/3-198 cath|current|2zkiB00/3-197 cath|current|2zkiC00/3-197 cath|current|2zkiD00/3-196 cath|current|2zkiE00/1-196 cath|current|2zkiF00/3-197 cath|current|2zkiG00/3-197 cath|current|2zkiH00/3-197 WP_010978866.1.60790 2zki_A 2zki_B 2zki_C 2zki_D 2zki_E 2zki_F 2zki_G 2zki_H 273063.ST0872 gi|15921105|ref|NP_376774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]