SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921160|ref|NP_376829.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921160|ref|NP_376829.1|
Domain Number 1 Region: 94-206
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.23e-44
Family Amylase, catalytic domain 0.00000473
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000227
Family E-set domains of sugar-utilizing enzymes 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921160|ref|NP_376829.1|
Sequence length 217
Comment alpha-amylase [Sulfolobus tokodaii str. 7]
Sequence
MFGPSFLSENEVEFILWAPYQKKATLRLNEEKYDMEKDEKGYFRITVNAKEGDKYSFIID
KGEIPDPASRYQPDGVHGRSQLISLKYEWKSREVKIKPEDLIIYELHIGTFTQEGTFYSA
VEKLDYLVNLGVTAIEIMPVHQFPGKKDWGYDGVYLYAVQNTYGGPYAFMKFIDEAHQRG
LAVILDVVYNHVGPEGNYMMFLGPYYDVFRSLLFTKV
Download sequence
Identical sequences Q973H5
273063.ST0926 gi|15921160|ref|NP_376829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]