SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921212|ref|NP_376881.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15921212|ref|NP_376881.1|
Domain Number - Region: 16-58
Classification Level Classification E-value
Superfamily AF1782-like 0.00103
Family AF1782-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921212|ref|NP_376881.1|
Sequence length 104
Comment hypothetical protein ST0970 [Sulfolobus tokodaii str. 7]
Sequence
MEELIKKVEEKSINVEDLIILALSKVDPNEGVKIRLELAEKYLFEAKDYLSKGDVIQASE
KAYKTAEEIVKALTEKSTYQNINKQLKRRDGILIILAMLQQNYL
Download sequence
Identical sequences Q973C3
gi|15921212|ref|NP_376881.1| 273063.ST0970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]