SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921217|ref|NP_376886.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921217|ref|NP_376886.1|
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 8.51e-73
Family Purine and uridine phosphorylases 0.000000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921217|ref|NP_376886.1|
Sequence length 237
Comment 5'-methylthioadenosine phosphorylase [Sulfolobus tokodaii str. 7]
Sequence
MNPVHILAKKGDIAEKVIIAGDPSRVKSLSKFLEEPQLVNENRGFLIYTGKYKGERISIA
THGIGGPSIAIVLEELTMLGGRIFIRYGTSGALVPEVNIGDYVIVTGASYNPSSLVYQYF
KEQACVSATPDFEITMALYNSFKNKGLKFHLGNVFSSDAFYAEDEDFAKKWSERGNIAVE
MECATLFMLSKLRKIRSGAVVIISDSLVKGGWISKDELEKKVSDGAIAILDALINIT
Download sequence
Identical sequences F9VNS5
273063.ST0975 gi|15921217|ref|NP_376886.1| WP_010978977.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]