SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921220|ref|NP_376889.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921220|ref|NP_376889.1|
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-39
Family GHMP Kinase, N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 172-304
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.15e-18
Family Phosphomevalonate kinase (PMK) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921220|ref|NP_376889.1|
Sequence length 314
Comment hypothetical protein ST0978 [Sulfolobus tokodaii str. 7]
Sequence
MISAPGKILWIGSYSVVFGGISHVIAINKRVRCDIKSSNNFIFETTYGTFKDKGNELIES
VITVFKEKFGSLPPFHVKLFNDKDFQIHGKKTGLGSSSASTVALTACIYYYLFKNLNKDE
IYKLAQKANYIRQKGIGSGFDIASAVYGSIVYRRFYDIEKVDSVIEPLKIGNYEMLLGFI
GESFSTVNSVAKFIEKSNNEEFKKVMKYIDEENIMAIKLIKLGKIEEAIEHVKLARRFLN
GLAKKIVGVEIENEKIRRLIEMAENDALIALSPGAGGESVFVLGKDLSKVKEKWEKENVI
VIELKEDEGLRIEA
Download sequence
Identical sequences Q973B5
273063.ST0978 gi|15921220|ref|NP_376889.1| WP_010978980.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]