SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921265|ref|NP_376934.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921265|ref|NP_376934.1|
Domain Number 1 Region: 11-195
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.44e-27
Family FAD-linked oxidases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921265|ref|NP_376934.1|
Sequence length 372
Comment hypothetical protein ST1019 [Sulfolobus tokodaii str. 7]
Sequence
MDFLSKYFKEVITSIDILEKYSTDYSYISPIISSMKKIPKAVIKIKSEEDIKKVIELMNE
YHFPVIVRGKGTNTLGATIPIKENTVILDITGLKGFEKSKGCLLAYTGTEFNEPGINDLP
VIPTSFYMATVGGFVEGGSLGFGSLKNGAVWDNVIEAEVYTLKGKYTLTGNEVYSIVQSA
GTTGILTRIKFRLVKNRKGIEIEKQKFNSLSEAINFSLKVIDYAEFISIRNYPMAKEIEP
GENWSKWNVIYGIESDKGFQLKDIITTFAGAYFTVVNKTGLYYNSLDISLDELEKIDTQD
CYVSAELSKSSIKYFSHTYFIGCNKLPNVGKMFNLHSYKINDRVEERRLKYIINFKRKVD
PEDLFNSGKLDF
Download sequence
Identical sequences Q972X0
WP_010979025.1.60790 gi|15921265|ref|NP_376934.1| 273063.ST1019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]