SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921270|ref|NP_376939.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921270|ref|NP_376939.1|
Domain Number 1 Region: 80-148
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 5.36e-28
Family Cyanase C-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000236
Family SinR domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921270|ref|NP_376939.1|
Sequence length 148
Comment cyanate hydratase [Sulfolobus tokodaii str. 7]
Sequence
MIDKKELREISLKKKREKRLTWEEIGKYLGRDKVYAAMLLYGYAQATEEEADKIITLLDL
PKELKPAFLDAPMRTPAQPWPPTDPFIYRLYEGVLLYGPVIKDVAHELFGDGIMSMIDVK
IYVDKVIENNYPRMVLTFNGKWLYYSKW
Download sequence
Identical sequences Q972W5
gi|15921270|ref|NP_376939.1| WP_010979030.1.60790 273063.ST1023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]