SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921340|ref|NP_377009.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921340|ref|NP_377009.1|
Domain Number 1 Region: 170-268
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000628
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 58-127
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000017
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921340|ref|NP_377009.1|
Sequence length 271
Comment hypothetical protein ST1087 [Sulfolobus tokodaii str. 7]
Sequence
MKVVKYLIPYVLISSFNYYFAKEAISSASPIVFNLIRYLISTAIFVSLSKKVIFSKDIIQ
LAIYTTASSLLWAYGLLYVTPAESAVLSYTMPLFSIPIALLVLSENPTLIEIIGVIIGFS
GVILYGLPLIHGFTLLGSIVTVVNAIFWASFSVYYRKLREYDPLVVNSSQFAIGSIILTL
LLPIDYKVDLNEQFAYGIVYTSIPGGALSFFLWNMMVKIEKISRVTVLSFSVPILTTLVE
YILYGTPPLLIQIIGIILMFIGILVSRIRKI
Download sequence
Identical sequences Q972P6
273063.ST1087 gi|15921340|ref|NP_377009.1| WP_010979100.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]