SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921350|ref|NP_377019.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921350|ref|NP_377019.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.01e-50
Family Transposase IS200-like 0.000000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921350|ref|NP_377019.1|
Sequence length 136
Comment transposase [Sulfolobus tokodaii str. 7]
Sequence
MEYKSTRHVKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDH
IHLFVNCPPRYAPSYLANYFKGKSARLILKKFPELKKATNGKLWTRSYFVSTAGNVSSET
IKKYIEEQWAKENEED
Download sequence
Identical sequences Q972N6
WP_010979110.1.60790 273063.ST1096 gi|15921350|ref|NP_377019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]