SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921515|ref|NP_377184.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921515|ref|NP_377184.1|
Domain Number 1 Region: 23-152,420-541
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.57e-88
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.000017
Further Details:      
 
Domain Number 2 Region: 227-393
Classification Level Classification E-value
Superfamily GroEL apical domain-like 9.42e-59
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000242
Further Details:      
 
Domain Number 3 Region: 161-231,383-418
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.32e-25
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921515|ref|NP_377184.1|
Sequence length 568
Comment thermosome, alpha subunit [Sulfolobus tokodaii str. 7]
Sequence
MQNQIRCLNMANAPVLLLKEGTQRSSGRDALKNNILAAVTLAEMLKSSLGPRGLDKMLID
SFGDVTITNDGATIVKEMEIQHPAAKLLVEAAKAQDAEVGDGTTSAVVLAGLLLDKADDL
LDQNIHPTIIIEGYKKALNKSLEIIDQLATKIDVSNLNSLATRDQLKKIVYTTMSSKFIA
GGEEMDKIMNMVIDAVSIVAEPLPEGGYNVPLDLIKIDKKKGGSIEDSMLVHGLVLDKEV
VHPGMPRRVEKAKIAVLDAALEVEKPEISAKISITSPEQIKAFLDEEAKYLKDMVDKLAS
IGANVVICQKGIDDVAQHFLAKKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLG
YAELVEERRVGNDKMVFIEGAKNPKAVNILLRGSNDMALDEAERSINDALHSLRNVLMKP
MIVAGGGAVETELALRLREYARSVGGKEQLAIEKFAEALEEIPMILAETAGMEPIQTLMD
LRAKHAKGLINAGVDVMNGKIADDMLALNVLEPVRVKAQVLKSAVEAATAILKIDDLIAA
APLKSGEKKGEKKEGGEEEKSSTPSSLE
Download sequence
Identical sequences gi|15921515|ref|NP_377184.1| 273063.ST1253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]