SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921611|ref|NP_377280.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921611|ref|NP_377280.1|
Domain Number 1 Region: 73-152
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000279
Family Polyphosphate kinase C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921611|ref|NP_377280.1|
Sequence length 348
Comment hypothetical protein ST1330 [Sulfolobus tokodaii str. 7]
Sequence
MLFIKFYYFIMIKTVMKPCINLLECIDSGVRAVKIAVAYVKRSGVNRFSEFLQNTKECLI
ITSLDFGITELEGLKELKRLGCNVYLYNGGNEFHPKVYILDYGYKKIAVIGSSNLSEGAI
TGKNIEFNLIVEEDEIVREAEVLINKLLSESDPVTDDLISQLEKNGYEKIRRAVYDKPGK
VILSILRNRQRYCEEFVKLYNEIRQHKERGKMAGLRKKSHEMGINKVACDLISKGIDVGD
EVGSDITVYAGKSKIRIKVQGMVLPNNPARVYDLDFDYFIIVVVTDLNSADYFIIERNEV
ERLIKEGLIKYKKGSEKYGWIPRKVYEKYKIDLDDLVNKLREAKLSRA
Download sequence
Identical sequences Q971N1
gi|15921611|ref|NP_377280.1| 273063.ST1330 WP_010979367.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]