SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921637|ref|NP_377306.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921637|ref|NP_377306.1|
Domain Number 1 Region: 6-126,241-396
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.49e-86
Family Substrate-binding domain of HMG-CoA reductase 0.00000497
Further Details:      
 
Domain Number 2 Region: 129-243
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.15e-44
Family NAD-binding domain of HMG-CoA reductase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921637|ref|NP_377306.1|
Sequence length 411
Comment 3-hydroxy-3-methylglutaryl-CoA reductase [Sulfolobus tokodaii str. 7]
Sequence
MQEIIDEVVNKALKGEIELHEIDNFLEANAAMVARRLVIEKLTNTKLPSIGSTILDYAEI
KNRNAENVIGGIQIPVGVIGPLRVNGDYAKGDFYVPLATTEGALIASVNRGAKAITKSGG
ARVKIIFDGMTRAPVFKLNSIEDVADFLKWIKDNFSKIKEIAESTTSHGKLMNIEPYVLG
NNVWLRFVFETGDAMGMNMVTVATEKACEFIEREFGRAVCLAVSGNMCSDKKQSQVNSLH
GRGKTVVAEALIPNDVIKTVLKSDSVLIHEVNLRKNWLGGARAGTMFQFNAHFANIVTAI
FIATGQDVAQVVESSSGYTWTEIRDNGLYISVTLTSLEVGTIGGGTRLPTQREALSIMRV
DGPGNPPGSNARKFAEIVASTVLAGELNLLAALANKELGKAHLRLGRGAKV
Download sequence
Identical sequences F9VP30
273063.ST1352 gi|15921637|ref|NP_377306.1| WP_010979393.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]