SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921664|ref|NP_377333.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921664|ref|NP_377333.1|
Domain Number 1 Region: 112-386
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.04e-79
Family NadC C-terminal domain-like 0.000000256
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 8.68e-33
Family NadC N-terminal domain-like 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921664|ref|NP_377333.1|
Sequence length 389
Comment nicotinate phosphoribosyltransferase [Sulfolobus tokodaii str. 7]
Sequence
MKFYIASEEDILSGKITDIYFERAEQTLKHLGISNVKVRMEIHSYGLPEGYKWAVFAGLE
EVLRLFEGKPVDIYAMPEGTLFKEIEPVMIIEGNYLDFGVFETAFLGMLRHSSSIATKAA
RIKSLAMDKTVLFFGLRALHPAIAPMADRSAYIGGCDGISGAFDREYFNIEPSGTMPHAL
MLVVGDNVKAWKAFDEAMPPSVPRIILSDTFEDERTEALKAAELLKDRIYGVRLDTPSSR
RGNFRKIIQEVRWTLNIHGYNNVKIIVSGGIDEDDVVNLRDVVDGFGVGTSIAFPPSVDF
SADIVEKYVDGKWIPFTKRGKWPGAKQVYRCGPTPDHDVITLLDGKPPSSDCRPLLVKYM
ENGKLIRSLPSIKEIREYVLQQLKKITQQ
Download sequence
Identical sequences Q971H8
gi|15921664|ref|NP_377333.1| WP_010979420.1.60790 273063.ST1376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]