SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921725|ref|NP_377394.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921725|ref|NP_377394.1|
Domain Number 1 Region: 170-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-77
Family RecA protein-like (ATPase-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 453-539
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 6.54e-21
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0032
Further Details:      
 
Domain Number 3 Region: 3-75
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000000275
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|15921725|ref|NP_377394.1|
Domain Number - Region: 116-180
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0432
Family Biotinyl/lipoyl-carrier proteins and domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15921725|ref|NP_377394.1|
Sequence length 595
Comment V-type ATP synthase subunit A [Sulfolobus tokodaii str. 7]
Sequence
MSNMVSEGRVVRVNGPLVIADGMREAQMFEVVYVSDLKLVGEITRIEGDRAFIQVYESTD
GVKPGDKVYRSGAPLSVELGPGLIGKIYDGLQRPLDSIAKVSNSPFVARGVSIPALDRQT
KWHFVPKVKSGDKVGPGDIIGVVQETDLIEHRILIPPNVHGTLKELAREGDYTVEDVVAV
VDMNGDEIPVKMYQKWPVRIPRPYKEKLEPVEPLLTGIRVLDTVFPIAKGGTAAIPGPFG
SGKTVTLQSLAKWSAAKVVIYVGCGERGNEMTDELRSFPKLKDPWTGKPLLLRTILVANT
SNMPVAARESSIYVGVTMAEYFRDQGYDVLLVADSTSRWAEALRDLGGRMEEMPAEEGFP
SYLPSRLAEYYERAGRVIALGNPERYGSVTIASAVSPPGGDFTEPVTSNTLRFVRVFWPL
DVSLAQARHYPAINWIQGFSAYVDLVAQWWHKNVDPNWKEMRDTMMKVLIREDELRQIVR
LVGPESLAEKDKLVLEAAKLIKDAFLKQNAYDDIDAFSSPQKQVRIMRLIYIFYNQSQDL
ISKGVPLKKILDKVGPIEPEIIRIKYTIKNDELNKIDEIENKLKATFDSLLKEVS
Download sequence
Identical sequences 273063.ST1436 gi|15921725|ref|NP_377394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]