SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921757|ref|NP_377426.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921757|ref|NP_377426.1|
Domain Number 1 Region: 18-107
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 4.67e-26
Family HisE-like (PRA-PH) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921757|ref|NP_377426.1|
Sequence length 108
Comment phosphoribosyl-AMP cyclohydrolase [Sulfolobus tokodaii str. 7]
Sequence
MKVSYFMLTVLVLGMSSNVLDTLYSIILDRISNKKEGSYTVKLLEKGKPYIARKVGEEAT
EVIVASLSEGRERFISEVADLIYHLFVLMAVEGVKPEDVYEELKRRMK
Download sequence
Identical sequences gi|15921757|ref|NP_377426.1| 273063.ST1465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]