SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15921842|ref|NP_377511.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921842|ref|NP_377511.1|
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-36
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921842|ref|NP_377511.1|
Sequence length 194
Comment hypothetical protein ST1548 [Sulfolobus tokodaii str. 7]
Sequence
MLVDTSLPDNYENLEKYLKSWGYSIEDISDIIITHAHPDHFGNAERIKREAKAKIYAHEE
EKFEMKKVKFEDVEKEFNNVSDTEIQKTLDRINNMKVEIPTVDVKLKGGEELGGFRVIHV
PGHTKGHIALMGEGVLIVGDAIRNINGVKPPIRFFCWDYEKALRSFNYLLSLPFRVLIPY
HGDILHEYNAYYFI
Download sequence
Identical sequences Q970Q3
gi|15921842|ref|NP_377511.1| 273063.ST1548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]