SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921909|ref|NP_377578.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15921909|ref|NP_377578.1|
Domain Number 1 Region: 176-269
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000418
Family Multidrug resistance efflux transporter EmrE 0.033
Further Details:      
 
Domain Number 2 Region: 55-134
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000484
Family Multidrug resistance efflux transporter EmrE 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15921909|ref|NP_377578.1|
Sequence length 270
Comment hypothetical protein ST1609 [Sulfolobus tokodaii str. 7]
Sequence
MIKRGILDLVTASALWGTIGIVTQIGYEHNANVFQIILFRSLSSSLLVFMVFRNVKTILD
RISLIMGVVAVIFYETYVYSVNILGASLSAVFLYTAPLWVILASKVYLKDEINNRKILAS
ILVVIGVYLIYFSKISIVSIGWGIASGFTYALLIIYSRFMQIKGYKDQEILASQAFWSLP
FSLLFLILSPDLTGSSILTGIYLGIVATFLAYIFFYRGMRLTDSITASIISSLEPVFTII
FAIIILHQILTPLQFLGSGIIIFSSILISL
Download sequence
Identical sequences Q970I6
273063.ST1609 WP_010979665.1.60790 gi|15921909|ref|NP_377578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]