SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15921940|ref|NP_377609.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15921940|ref|NP_377609.1|
Domain Number - Region: 20-82
Classification Level Classification E-value
Superfamily AF1782-like 0.00196
Family AF1782-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15921940|ref|NP_377609.1|
Sequence length 153
Comment hypothetical protein ST1637 [Sulfolobus tokodaii str. 7]
Sequence
MIKNNFSCDKSRLCFLKSLNYILFVEELIKRAKEYNIDVNDLIIDAISRKDPKEAFNLRI
ELAKKYFAEAEDYLAKGDAIQASEKAYETAEEIVKALAEKFNTPECQQAMREGRWFTYWL
ASAVNRLSKDLGDWVLNGWNSAYTLHVWGFHEA
Download sequence
Identical sequences Q970F5
273063.ST1637 gi|15921940|ref|NP_377609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]