SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922050|ref|NP_377719.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15922050|ref|NP_377719.1|
Domain Number - Region: 12-57
Classification Level Classification E-value
Superfamily AF1782-like 0.000114
Family AF1782-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15922050|ref|NP_377719.1|
Sequence length 109
Comment hypothetical protein ST1740, partial [Sulfolobus tokodaii str. 7]
Sequence
MEELIKRAEEKGIDVEDLILSALSRVDPQAGIRTRLELAKKYLSEAEEYLSKGDIVLSSE
KAYKVAEELVKALAEKFNLPEYQQAVREGRWYTYSLTNAVAKLSLKLGD
Download sequence
Identical sequences Q96ZU5
273063.ST1740 gi|15922050|ref|NP_377719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]