SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922211|ref|NP_377880.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922211|ref|NP_377880.1|
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily Single hybrid motif 7.98e-34
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15922211|ref|NP_377880.1|
Sequence length 148
Comment glycine cleavage system protein H [Sulfolobus tokodaii str. 7]
Sequence
MANVSNCEIPENLLYFIEGKNTVWAKQEAPDVIVVGITDIAQTMAGKVVKVRLKKKGTKV
ERGKPVATMESGKWAGPVPAPASGEIIDVNPDVEKNPVLVNQDPYGKGWLVKMKVNNPEE
LKQLVTGSAAVSKLTELINSEKLQCKRL
Download sequence
Identical sequences Q96ZD6
WP_010979966.1.60790 273063.ST1895 gi|15922211|ref|NP_377880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]