SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922222|ref|NP_377891.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922222|ref|NP_377891.1|
Domain Number 1 Region: 49-132
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000851
Family Cgl2762-like 0.038
Further Details:      
 
Weak hits

Sequence:  gi|15922222|ref|NP_377891.1|
Domain Number - Region: 8-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.015
Family Transcriptional factor domain 0.04
Further Details:      
 
Domain Number - Region: 158-214
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0301
Family CorA soluble domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15922222|ref|NP_377891.1|
Sequence length 244
Comment insertion element protein [Sulfolobus tokodaii str. 7]
Sequence
MGRKPVIRHDIACPSCGSHHVVKCGKPPGRQRFLCRDCGKYFLADAVYHHHSKEVREEAL
RMYTNGMSMRAISRVLNVPLGTVFTWVKRYGKRKYEKLVDLWNKAKELVKGKVVTKVVDE
MWTYLYRNTRAFYKWVFTCYVYTRLGLYIIYSVGDRDENTFREVKDYVPDDGRWVSDDYN
VYFWLKDHTVVSLVNPNESFHSSLRDRLVRFKRATKAVNRSINMVKYSIALVLWERRLIP
EFVA
Download sequence
Identical sequences Q96ZC5
273063.ST1907 WP_010979977.1.60790 gi|15922222|ref|NP_377891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]