SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922234|ref|NP_377903.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922234|ref|NP_377903.1|
Domain Number 1 Region: 23-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.91e-19
Family Nucleotide and nucleoside kinases 0.072
Further Details:      
 
Weak hits

Sequence:  gi|15922234|ref|NP_377903.1|
Domain Number - Region: 239-298
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0508
Family Cgl2762-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922234|ref|NP_377903.1|
Sequence length 412
Comment hypothetical protein ST1919 [Sulfolobus tokodaii str. 7]
Sequence
MRVYYYMNIEELKRVIKDQREYLESLEKQKIIERELPFNVEQYLSKPNILAILGVRRSGK
STLGYLLVREKNFAYIDFSDDRLVNFTDFDTLTKAFYELYGDFTHVLIDEPQYVNGWELF
VNRLRKEKSVIITGSNSSLLSGELASALTGRHVDLILFPFSFKEYLTFRGVKVDLYSTKS
ISLIKNELENYLKEGGFPETLSLGKRIIPSIYNDIITKDVIGRYKIRDVVKFKEFVNSMV
KYYSTEISVRKLANLLKISTRTIEEWLNAIQESYLLFFVRRYSRSPKQFNGQRKVYVIDA
GIVNYLTSFSYGGLMENVVAIQLLRKNQLEGIYYLRGEDYEVDFVDEKNGELIQVSYVSS
QDEINRNEIRSLVKGSQITEFNKLTIVSWDLEDEIIVEGKKIRIVPLWKYLI
Download sequence
Identical sequences Q96ZB4
gi|15922234|ref|NP_377903.1| sto001001919.1 273063.ST1919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]