SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922407|ref|NP_378076.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922407|ref|NP_378076.1|
Domain Number 1 Region: 172-270
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000144
Family Multidrug resistance efflux transporter EmrE 0.0082
Further Details:      
 
Domain Number 2 Region: 39-129
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000196
Family Multidrug resistance efflux transporter EmrE 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15922407|ref|NP_378076.1|
Sequence length 274
Comment hypothetical protein ST2085 [Sulfolobus tokodaii str. 7]
Sequence
MKRLGIVEMIVTTVIWGSIPILALLSDLPSPVFVFFRVFLTSLFLFPIVKKIRPKLLLKI
TILLSGLSLALNWIFLFYSIRLVQVSEAILLYYTGPIFATIIMHFLGERINGVKLISILL
AFGGIILILDPTEMSLNLGIYVALLSGLFYGILAVTSKLSTKLVSSKELVLYQTIIASAL
TFPFLFAFKFSFTLYTAIIVLVAALVNTLLALFLWYDALTKISVQLASVLSYLDPVFAII
FAYIFLAQMPSTMTIVGGILIIVGGIISIFAETF
Download sequence
Identical sequences Q96YU1
WP_010980161.1.60790 273063.ST2085 gi|15922407|ref|NP_378076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]