SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922476|ref|NP_378145.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922476|ref|NP_378145.1|
Domain Number 1 Region: 36-209
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.67e-43
Family FAD-linked oxidases, N-terminal domain 0.093
Further Details:      
 
Domain Number 2 Region: 502-600
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.000000000000227
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0078
Further Details:      
 
Domain Number 3 Region: 214-460
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.000000000262
Family D-lactate dehydrogenase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15922476|ref|NP_378145.1|
Sequence length 1000
Comment hypothetical protein ST2149 [Sulfolobus tokodaii str. 7]
Sequence
MGLREELEARFGNNFSDSLVERLSHSADMGFVPQLVWAGIKINIIPDYVIYPTSVEDVID
AVKIALKYKVPITPYGRGTNRYGNALTTEGGILLDFSKMDKVEIDESNMVAITEPGATWK
LVDLAAQNKGLQLRTFPSSYDSTVGGGIAGDALGIGSYEYGFISDNISFVDMINPKGELI
HLEGGNLALVAGAEGTTGIIVKAGIRLRKYSPTEALVLSFNSFDDAIKAIGEFYREVIPA
WHVQVRGPTISSYIAQKFNAKLSPGKWNMIILYPSLRSSLVEPKLYRIAQAFSAEVYEGE
WTGWWSFNHGVVAALRTKGLLIHQHGLIHYTKINDLVKELEGTLGRLGELSPNSGFDLDI
DLEKREVLLVNAFTEVSLKPNDKKLIYDLAKNTLMMDSFVKVGGSLLSIGMFGHKYSRNR
LSAMGKTFQQLGIDRYEVIKKYKEEMDPEELFNPGKVFDPKKRGKVVFEIVRRQQEALQF
RFGIGFVKAVVPGGEVSGYSAVKRFLDIFTDYSLECIDCAMCVTVCPQFRLIPQVPYAPK
GMFDFVKGAISYHHLYGSVDIPDSAIAEISGCHKCGLCDGVCPAKIPISSLLVKLNSIVA
KKVPEEPPVKIPLTQDSEVASVVDNNSDIALWVGKYLVDNPTVAIAALKILKALGLKVKL
VGTEYDSGFMSYISGGEKLQQKIKSNEEILSNSLEVITIAPEDYKVLSEVYRDYANMLGL
KVTYEVSPIDIRVLKSIQIDGKGEEIYLHVACFSSSYANDVIRRLSDMGFRVRKVEGCSG
AVLEKNIGKRADMMARALGSKYPMLITLCPLAAAKFRESGVNAKTLIEFIAEKLRINIPT
EVKVSKIELSLAERNSLQATVLNSIVNALTKRVNLIADTVTFTSSGVDEYKKIIEPLVKE
ALEDASNSINNYVSSIVEEKKKNGMKYEDLIAYLSSLTKELNAVISSIQFDSIADGIVEQ
VKRQSTEEFDVSVLKSSLVFLIRDNEQLLKEKSIKMLNVS
Download sequence
Identical sequences Q96YM3
WP_010980229.1.60790 gi|15922476|ref|NP_378145.1| 273063.ST2149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]