SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922513|ref|NP_378182.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922513|ref|NP_378182.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.87e-40
Family GHMP Kinase, N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 172-309
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.79e-23
Family Mevalonate kinase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922513|ref|NP_378182.1|
Sequence length 312
Comment hypothetical protein ST2185 [Sulfolobus tokodaii str. 7]
Sequence
MIEVKVPLKLTLFGEHAVVYERPAIAYTISEFLTLRFKESDKFYIKSDNLQIKGVRVNID
EFKIENENIKRVLSYIIEGINYFEAKKPVEIEIESPVEPSVGLGTSAGVVVGTVAGYSSY
LGIELSKEEIAKISHSIELKVQGLGSRMDTYTETFGGFIYIEKDKFEKLSSNLSFSAGYF
RRVTTTAEMLKRVKQIKEKKRELFDSILDTIAEITIEAKKALQDNDEDSIGELMYINHGL
LFSLGITVPQIDEFISTTRMANVKGCKISGGGAGGAVVCTKDERAELLLTAMGGKVINAT
PSFLGVQVIRRT
Download sequence
Identical sequences Q96YI6
WP_010980266.1.60790 273063.ST2185 gi|15922513|ref|NP_378182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]