SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922545|ref|NP_378214.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922545|ref|NP_378214.1|
Domain Number 1 Region: 27-157
Classification Level Classification E-value
Superfamily Nqo5-like 3.66e-43
Family Nqo5-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922545|ref|NP_378214.1|
Sequence length 168
Comment NADH dehydrogenase subunit C [Sulfolobus tokodaii str. 7]
Sequence
MKFMAQTVQSILNSIFSQVQSKFKVTGKVESDKRASIQVDKSQIVEVAGFLKSLGFDHVK
SVTAIDYPDAQEFEVVYHISSYSNIDLAKTIVALRTRVKYDDPKLPSLYKIWESVWTGER
ETYEMYGIIFDGHPDLRRLFLPEDFEGVYPMRKSYKIKTEGLFVDKPS
Download sequence
Identical sequences Q96YF4
273063.ST2217 gi|15922545|ref|NP_378214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]