SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922555|ref|NP_378224.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922555|ref|NP_378224.1|
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 8.5e-48
Family Type 2 phosphatidic acid phosphatase, PAP2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15922555|ref|NP_378224.1|
Sequence length 203
Comment hypothetical protein ST2226 [Sulfolobus tokodaii str. 7]
Sequence
MRKYWFLLFIFIILSIYLKIIGEYNFPLNVLLFKIINYHQIALLNSFFVFFSKYGREYVW
IPLTAILLIFKRTRRIAITLAASFILAIILGEASKIIMAQLRPFYYIHADLLVPPPHDYS
YPSGHALIVGDGAMVLYKTSPRWLWIPFFIEALIVSYSRVYVGVHWPIDILGGWLLGSWI
AYFTVDMESKGILRPIEKLFKVS
Download sequence
Identical sequences F9VPB8
gi|15922555|ref|NP_378224.1| 273063.ST2226 WP_010980308.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]