SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922577|ref|NP_378246.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922577|ref|NP_378246.1|
Domain Number 1 Region: 35-290
Classification Level Classification E-value
Superfamily SIS domain 2.62e-46
Family double-SIS domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15922577|ref|NP_378246.1|
Sequence length 311
Comment bifunctional phosphoglucose/phosphomannose isomerase [Sulfolobus tokodaii str. 7]
Sequence
MNNPYENWINFFQEALNTNIPSIEKIEELVYLGIGGSGIPGRILEILELPVKYQLFRGYK
VKVNEKSTVIAVSYSGNTTETIFALLTSLKKTRKAIVITSGGKIEEIASKHNLPVIKLPK
GLQTRFVFPYIFTYLIRIINEGLGTNYNVNELVEGIKDYSKLNEISGILASQIIGKIPII
YSSTFLPIAERFKQEINENAKYPAFYNELPEANHNEIELYSYPSPYTFYPIVIVSDKLDE
ESANLINAYKIYPLYQSILKNIASLTLLAGLTSVKLAMLLGVKPEQLNIIPKIREKTFKL
FEGDINADQNL
Download sequence
Identical sequences Q96YC2
gi|15922577|ref|NP_378246.1| 273063.ST2245 WP_010980330.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]