SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15922656|ref|NP_378325.1| from Sulfolobus tokodaii str. 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15922656|ref|NP_378325.1|
Domain Number 1 Region: 126-338
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.23e-69
Family Creatinase/aminopeptidase 0.00000416
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 6.41e-19
Family Creatinase/prolidase N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15922656|ref|NP_378325.1|
Sequence length 353
Comment X-Pro dipeptidase [Sulfolobus tokodaii str. 7]
Sequence
MKRIARLRELMKERMIDYVILGPGSNMFYLTGFTEEQMERPLFLIIDSWNVYFLAPKLYE
EQLSHFNIPVVSYSDDENPYKKLNIEKGKSIAIDDTLWSSFTIDIINNFSPSQIIKANEI
MKELRIIKQDEEIEIMKEGVRIAEKSFLNAINHIKPGLNEKKIAKMLVDEFLNNGADGVS
FEPIVTSGPNTSMPHLRSTTREIKQGDILIFDFGIKYKGYSTDTTRVVSIGKPIEEIVKI
FEIVKEAQQKAEDMIKENVQACEIDKVARQVISNYGFSKYFIHRTGHGIGIDVHEEPYIA
PNYKRKIEKNMVFTIEPGIYLPEKFGIRIEDMVYVNSKAVVMNNLQKDEIFIV
Download sequence
Identical sequences F9VPD7
273063.ST2323 WP_010980409.1.60790 gi|15922656|ref|NP_378325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]